Solution Structure of the DNA-binding TubR fragment from Clostridium Botulinum
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.5 % (977 of 1023) | 95.4 % (514 of 539) | 97.7 % (385 of 394) | 86.7 % (78 of 90) |
Backbone | 96.9 % (469 of 484) | 95.1 % (156 of 164) | 97.9 % (235 of 240) | 97.5 % (78 of 80) |
Sidechain | 94.8 % (585 of 617) | 95.5 % (358 of 375) | 97.8 % (227 of 232) | 0.0 % (0 of 10) |
Aromatic | 95.2 % (59 of 62) | 90.3 % (28 of 31) | 100.0 % (31 of 31) | |
Methyl | 97.8 % (90 of 92) | 97.8 % (45 of 46) | 97.8 % (45 of 46) |
1. entity 1
MAVNKNEYKI LIMLKENQCT TELKSFTYTK LCNISKLSMS TVRRSIKKFL ELQYVKEGCK QGISKTFYIT PNGIEKLKSI MSolvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz crioprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz crioprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz crioprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz crioprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz crioprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz PATXI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz PATXI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz PATXI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz crioprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz PATXI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz PATXI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz PATXI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz PATXI probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Bruker AVANCE - 600 MHz crioprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 (±0.05) atm, Temperature 298 (±0.1) K, pH 6.4 (±0.1), Details 225 uM [U-15N] TubR, 25 mM potassium phosphate, 50 mM potassium chloride, 2 mM D-10 DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TubR | [U-15N] | 225 (±1.0) uM | |
2 | potassium phosphate | natural abundance | 25 (±0.1) mM | |
3 | potassium chloride | natural abundance | 50 (±0.1) mM | |
4 | DTT | D-10 | 2 (±0.1) mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr34449_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80- MAVNKNEYKILIMLKENQCTTELKSFTYTKLCNISKLSMSTVRRSIKKFLELQYVKEGCKQGISKTFYITPNGIEKLKSIM ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..VNKNEYKILIMLKENQCTTELKSFTYTKLCNISKLSMSTVRRSIKKFLELQYVKEGCKQGISKTFYITPNGIEKLKSIM
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 539 | 523 | 97.0 |
13C chemical shifts | 394 | 381 | 96.7 |
15N chemical shifts | 90 | 77 | 85.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 164 | 159 | 97.0 |
13C chemical shifts | 162 | 156 | 96.3 |
15N chemical shifts | 80 | 77 | 96.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 375 | 364 | 97.1 |
13C chemical shifts | 232 | 225 | 97.0 |
15N chemical shifts | 10 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 45 | 90.0 |
13C chemical shifts | 50 | 45 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 31 | 100.0 |
13C chemical shifts | 31 | 31 | 100.0 |