NMR structure of the apo-form of Pseudomonas fluorescens CopC
HAHLKSATPA ADSTVAAPAD LRLTFSEGVE ATFTKVSLSK DGTEVAIKGL ETPDADKKTL VVTPAAPLAA GNYKVVWNAV SVDTHKSNGE YSFKVGQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.4 % (969 of 1049) | 90.0 % (478 of 531) | 95.2 % (400 of 420) | 92.9 % (91 of 98) |
Backbone | 98.8 % (565 of 572) | 98.5 % (192 of 195) | 99.3 % (283 of 285) | 97.8 % (90 of 92) |
Sidechain | 87.1 % (495 of 568) | 85.1 % (286 of 336) | 92.0 % (208 of 226) | 16.7 % (1 of 6) |
Aromatic | 85.7 % (60 of 70) | 85.7 % (30 of 35) | 85.3 % (29 of 34) | 100.0 % (1 of 1) |
Methyl | 93.7 % (118 of 126) | 93.7 % (59 of 63) | 93.7 % (59 of 63) |
1. entity 1
HAHLKSATPA ADSTVAAPAD LRLTFSEGVE ATFTKVSLSK DGTEVAIKGL ETPDADKKTL VVTPAAPLAA GNYKVVWNAV SVDTHKSNGE YSFKVGQSolvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Bruker AVANCE III - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 bar, Temperature 298 K, pH 5.6, Details 0.7 mM [U-100% 13C; U-100% 15N] CopC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | CopC | [U-100% 13C; U-100% 15N] | 0.7 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr34464_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90------- HAHLKSATPAADSTVAAPADLRLTFSEGVEATFTKVSLSKDGTEVAIKGLETPDADKKTLVVTPAAPLAAGNYKVVWNAVSVDTHKSNGEYSFKVGQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HAHLKSATPAADSTVAAPADLRLTFSEGVEATFTKVSLSKDGTEVAIKGLETPDADKKTLVVTPAAPLAAGNYKVVWNAVSVDTHKSNGEYSFKVGQ
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 531 | 477 | 89.8 |
13C chemical shifts | 420 | 400 | 95.2 |
15N chemical shifts | 98 | 90 | 91.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 195 | 191 | 97.9 |
13C chemical shifts | 194 | 192 | 99.0 |
15N chemical shifts | 92 | 89 | 96.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 336 | 286 | 85.1 |
13C chemical shifts | 226 | 208 | 92.0 |
15N chemical shifts | 6 | 1 | 16.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 59 | 93.7 |
13C chemical shifts | 63 | 59 | 93.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 30 | 85.7 |
13C chemical shifts | 34 | 29 | 85.3 |
15N chemical shifts | 1 | 1 | 100.0 |