De-novo Maquette 2 protein with buried ion-pair
SEFEKLRQTG DELVQAEQRL REIFDKGDDD SLEQVLEEIE ELIQKHRQLF DNRQEAADTE AAKQGDQWVQ LKQRFREAID KGDKDSLEQL LEELEQALQK IRELAEKKN
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.9 % (1323 of 1338) | 99.0 % (703 of 710) | 100.0 % (494 of 494) | 94.0 % (126 of 134) |
Backbone | 99.7 % (652 of 654) | 99.1 % (220 of 222) | 100.0 % (323 of 323) | 100.0 % (109 of 109) |
Sidechain | 98.4 % (776 of 789) | 99.0 % (483 of 488) | 100.0 % (276 of 276) | 68.0 % (17 of 25) |
Aromatic | 100.0 % (56 of 56) | 100.0 % (28 of 28) | 100.0 % (27 of 27) | 100.0 % (1 of 1) |
Methyl | 100.0 % (108 of 108) | 100.0 % (54 of 54) | 100.0 % (54 of 54) |
1. entity 1
SEFEKLRQTG DELVQAEQRL REIFDKGDDD SLEQVLEEIE ELIQKHRQLF DNRQEAADTE AAKQGDQWVQ LKQRFREAID KGDKDSLEQL LEELEQALQK IRELAEKKNSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Bruker AVANCE III - 950 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 7.5, Details 800 uM [U-13C; U-15N] Maquette 2-1ip, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Maquette 2-1ip | [U-13C; U-15N] | 800 uM |
Properties
Input source #1: Assigned chemical shifts - Assigned chemical shifts | bmr34518_3.str |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | OK |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr34518_3.str
# | Content subtype | Saveframe | Status | # of rows | Experiment type | Sequence coverage (%) |
---|---|---|---|---|---|---|
1 | Assigned chemical shifts | assigned_chemical_shifts_1 | OK | 1438 | 100.0 (chain: 1, length: 109) | |
1 | Chemical shift references | chem_shift_reference_1 | OK | 3 | No information |
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SEFEKLRQTGDELVQAEQRLREIFDKGDDDSLEQVLEEIEELIQKHRQLFDNRQEAADTEAAKQGDQWVQLKQRFREAIDKGDKDSLEQLLEELEQALQK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SEFEKLRQTGDELVQAEQRLREIFDKGDDDSLEQVLEEIEELIQKHRQLFDNRQEAADTEAAKQGDQWVQLKQRFREAIDKGDKDSLEQLLEELEQALQK --------- IRELAEKKN ||||||||| IRELAEKKN
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 710 | 710 | 100.0 |
13C chemical shifts | 494 | 494 | 100.0 |
15N chemical shifts | 134 | 126 | 94.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 222 | 222 | 100.0 |
13C chemical shifts | 218 | 218 | 100.0 |
15N chemical shifts | 109 | 109 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 488 | 488 | 100.0 |
13C chemical shifts | 276 | 276 | 100.0 |
15N chemical shifts | 25 | 17 | 68.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 54 | 100.0 |
13C chemical shifts | 54 | 54 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 28 | 100.0 |
13C chemical shifts | 27 | 27 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |