Structural evolution of the tissue-specific U2AF2 paralog and alternative splicing factor LS2
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.5 % (838 of 936) | 96.9 % (467 of 482) | 78.5 % (284 of 362) | 94.6 % (87 of 92) |
Backbone | 85.1 % (410 of 482) | 98.8 % (167 of 169) | 70.9 % (166 of 234) | 97.5 % (77 of 79) |
Sidechain | 95.1 % (500 of 526) | 95.8 % (300 of 313) | 95.0 % (190 of 200) | 76.9 % (10 of 13) |
Aromatic | 93.8 % (60 of 64) | 93.8 % (30 of 32) | 93.8 % (30 of 32) | |
Methyl | 91.0 % (91 of 100) | 92.0 % (46 of 50) | 90.0 % (45 of 50) |
1. entity 1
AMGNKIYVGG LPTCLNQDQV KELLQSFGEL KGLNLVMDTN TNLNKGFAFF EYCDPSVTDH AIAGLHGMLL GDRRLVVQRS ISolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM 13C 15N LS2 RRM2, 0.02 mM 13C 15N potassium phosphate pH 6.5, 0.05 mM 13C 15N sodium chloride, 0.002 mM 13C 15N DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 RRM2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate pH 6.5 | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE 800 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM 13C 15N LS2 RRM2, 0.02 mM 13C 15N potassium phosphate pH 6.5, 0.05 mM 13C 15N sodium chloride, 0.002 mM 13C 15N DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 RRM2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate pH 6.5 | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE 800 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM 13C 15N LS2 RRM2, 0.02 mM 13C 15N potassium phosphate pH 6.5, 0.05 mM 13C 15N sodium chloride, 0.002 mM 13C 15N DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 RRM2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate pH 6.5 | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE 800 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM 13C 15N LS2 RRM2, 0.02 mM 13C 15N potassium phosphate pH 6.5, 0.05 mM 13C 15N sodium chloride, 0.002 mM 13C 15N DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 RRM2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate pH 6.5 | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE 750 - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM 13C 15N LS2 RRM2, 0.02 mM 13C 15N potassium phosphate pH 6.5, 0.05 mM 13C 15N sodium chloride, 0.002 mM 13C 15N DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 RRM2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate pH 6.5 | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE 750 - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM 13C 15N LS2 RRM2, 0.02 mM 13C 15N potassium phosphate pH 6.5, 0.05 mM 13C 15N sodium chloride, 0.002 mM 13C 15N DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 RRM2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate pH 6.5 | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE 800 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM 13C 15N LS2 RRM2, 0.02 mM 13C 15N potassium phosphate pH 6.5, 0.05 mM 13C 15N sodium chloride, 0.002 mM 13C 15N DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 RRM2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate pH 6.5 | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE 900 - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM 13C 15N LS2 RRM2, 0.02 mM 13C 15N potassium phosphate pH 6.5, 0.05 mM 13C 15N sodium chloride, 0.002 mM 13C 15N DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 RRM2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate pH 6.5 | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE 800 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5 mM 13C 15N LS2 RRM2, 0.02 mM 13C 15N potassium phosphate pH 6.5, 0.05 mM 13C 15N sodium chloride, 0.002 mM 13C 15N DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 RRM2 | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate pH 6.5 | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr34555_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80- AMGNKIYVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTDHAIAGLHGMLLGDRRLVVQRSI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AMGNKIYVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTDHAIAGLHGMLLGDRRLVVQRSI
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 482 | 464 | 96.3 |
13C chemical shifts | 362 | 269 | 74.3 |
15N chemical shifts | 92 | 87 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 169 | 167 | 98.8 |
13C chemical shifts | 162 | 81 | 50.0 |
15N chemical shifts | 79 | 77 | 97.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 313 | 297 | 94.9 |
13C chemical shifts | 200 | 188 | 94.0 |
15N chemical shifts | 13 | 10 | 76.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 44 | 83.0 |
13C chemical shifts | 53 | 44 | 83.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 30 | 93.8 |
13C chemical shifts | 32 | 30 | 93.8 |