Structural evolution of the tissue-specific U2AF2 paralog and alternative splicing factor LS2
SISVSAMESY RSFRVPAINV AQQPAVTLPV TTIVPDSPNK IYVGGLPTCL NQDQVKELLQ SFGELKGLNL VMDTNTNLNK GFAFFEYCDP SVTDHAIAGL HGMLLGDRRL VVQRSIPGGK NA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.9 % (1126 of 1391) | 85.3 % (611 of 716) | 73.4 % (398 of 542) | 88.0 % (117 of 133) |
Backbone | 84.4 % (604 of 716) | 99.6 % (245 of 246) | 68.8 % (245 of 356) | 100.0 % (114 of 114) |
Sidechain | 80.4 % (633 of 787) | 77.9 % (366 of 470) | 88.6 % (264 of 298) | 15.8 % (3 of 19) |
Aromatic | 75.6 % (62 of 82) | 78.0 % (32 of 41) | 73.2 % (30 of 41) | |
Methyl | 80.5 % (124 of 154) | 77.9 % (60 of 77) | 83.1 % (64 of 77) |
1. entity 1
SISVSAMESY RSFRVPAINV AQQPAVTLPV TTIVPDSPNK IYVGGLPTCL NQDQVKELLQ SFGELKGLNL VMDTNTNLNK GFAFFEYCDP SVTDHAIAGL HGMLLGDRRL VVQRSIPGGK NASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-13C; U-15N] LS2 Linker RRM2, 0.02 mM [U-13C; U-15N] potassium phosphate, 0.05 mM [U-13C; U-15N] sodium chloride, 0.002 mM [U-13C; U-15N] DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 Linker RRM2 | [U-13C; U-15N] | 1.0 mM | |
2 | potassium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-13C; U-15N] LS2 Linker RRM2, 0.02 mM [U-13C; U-15N] potassium phosphate, 0.05 mM [U-13C; U-15N] sodium chloride, 0.002 mM [U-13C; U-15N] DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 Linker RRM2 | [U-13C; U-15N] | 1.0 mM | |
2 | potassium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-13C; U-15N] LS2 Linker RRM2, 0.02 mM [U-13C; U-15N] potassium phosphate, 0.05 mM [U-13C; U-15N] sodium chloride, 0.002 mM [U-13C; U-15N] DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 Linker RRM2 | [U-13C; U-15N] | 1.0 mM | |
2 | potassium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-13C; U-15N] LS2 Linker RRM2, 0.02 mM [U-13C; U-15N] potassium phosphate, 0.05 mM [U-13C; U-15N] sodium chloride, 0.002 mM [U-13C; U-15N] DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 Linker RRM2 | [U-13C; U-15N] | 1.0 mM | |
2 | potassium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-13C; U-15N] LS2 Linker RRM2, 0.02 mM [U-13C; U-15N] potassium phosphate, 0.05 mM [U-13C; U-15N] sodium chloride, 0.002 mM [U-13C; U-15N] DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 Linker RRM2 | [U-13C; U-15N] | 1.0 mM | |
2 | potassium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-13C; U-15N] LS2 Linker RRM2, 0.02 mM [U-13C; U-15N] potassium phosphate, 0.05 mM [U-13C; U-15N] sodium chloride, 0.002 mM [U-13C; U-15N] DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 Linker RRM2 | [U-13C; U-15N] | 1.0 mM | |
2 | potassium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-13C; U-15N] LS2 Linker RRM2, 0.02 mM [U-13C; U-15N] potassium phosphate, 0.05 mM [U-13C; U-15N] sodium chloride, 0.002 mM [U-13C; U-15N] DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 Linker RRM2 | [U-13C; U-15N] | 1.0 mM | |
2 | potassium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-13C; U-15N] LS2 Linker RRM2, 0.02 mM [U-13C; U-15N] potassium phosphate, 0.05 mM [U-13C; U-15N] sodium chloride, 0.002 mM [U-13C; U-15N] DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 Linker RRM2 | [U-13C; U-15N] | 1.0 mM | |
2 | potassium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-13C; U-15N] LS2 Linker RRM2, 0.02 mM [U-13C; U-15N] potassium phosphate, 0.05 mM [U-13C; U-15N] sodium chloride, 0.002 mM [U-13C; U-15N] DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 Linker RRM2 | [U-13C; U-15N] | 1.0 mM | |
2 | potassium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Bruker AVANCE - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1.0 mM [U-13C; U-15N] LS2 Linker RRM2, 0.02 mM [U-13C; U-15N] potassium phosphate, 0.05 mM [U-13C; U-15N] sodium chloride, 0.002 mM [U-13C; U-15N] DTT, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LS2 Linker RRM2 | [U-13C; U-15N] | 1.0 mM | |
2 | potassium phosphate | natural abundance | 0.02 mM | |
3 | sodium chloride | natural abundance | 0.05 mM | |
4 | DTT | natural abundance | 0.002 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr34556_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SISVSAMESYRSFRVPAINVAQQPAVTLPVTTIVPDSPNKIYVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTDHAIAGL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SISVSAMESYRSFRVPAINVAQQPAVTLPVTTIVPDSPNKIYVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTDHAIAGL -------110-------120-- HGMLLGDRRLVVQRSIPGGKNA |||||||||||||||||||||| HGMLLGDRRLVVQRSIPGGKNA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 716 | 598 | 83.5 |
13C chemical shifts | 542 | 381 | 70.3 |
15N chemical shifts | 133 | 116 | 87.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 246 | 245 | 99.6 |
13C chemical shifts | 244 | 122 | 50.0 |
15N chemical shifts | 114 | 114 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 470 | 353 | 75.1 |
13C chemical shifts | 298 | 259 | 86.9 |
15N chemical shifts | 19 | 2 | 10.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 80 | 59 | 73.8 |
13C chemical shifts | 80 | 64 | 80.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 27 | 65.9 |
13C chemical shifts | 41 | 27 | 65.9 |