Solution structure of the major fish allergen parvalbumin Sco j 1 derived from the Pacific mackerel
GPLGSMAFAS VLKDAEVTAA LDGCKAAGSF DHKKFFKACG LSGKSTDEVK KAFAIIDQDK SGFIEEEELK LFLQNFKAGA RALSDAETKA FLKAGDSDGD GKIGIDEFAA MIKG
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | metal coordination | sing | 1:ASP57:OD1 | 2:CA1:CA |
2 | metal coordination | sing | 1:ASP59:OD1 | 2:CA1:CA |
3 | metal coordination | sing | 1:SER61:OG | 2:CA1:CA |
4 | metal coordination | sing | 1:PHE63:O | 2:CA1:CA |
5 | metal coordination | sing | 1:GLU68:OE1 | 2:CA1:CA |
6 | metal coordination | sing | 1:GLU68:OE2 | 2:CA1:CA |
7 | metal coordination | sing | 1:ASP96:OD1 | 2:CA1:CA |
8 | metal coordination | sing | 1:ASP98:OD1 | 2:CA1:CA |
9 | metal coordination | sing | 1:ASP100:OD1 | 2:CA1:CA |
10 | metal coordination | sing | 1:LYS102:O | 2:CA1:CA |
11 | metal coordination | sing | 1:GLU107:OE1 | 2:CA1:CA |
12 | metal coordination | sing | 1:GLU107:OE2 | 2:CA1:CA |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.2 % (1196 of 1269) | 96.0 % (629 of 655) | 91.4 % (455 of 498) | 96.6 % (112 of 116) |
Backbone | 95.9 % (654 of 682) | 95.0 % (228 of 240) | 96.4 % (317 of 329) | 96.5 % (109 of 113) |
Sidechain | 93.2 % (641 of 688) | 96.6 % (401 of 415) | 87.8 % (237 of 270) | 100.0 % (3 of 3) |
Aromatic | 72.1 % (75 of 104) | 94.2 % (49 of 52) | 50.0 % (26 of 52) | |
Methyl | 96.5 % (110 of 114) | 96.5 % (55 of 57) | 96.5 % (55 of 57) |
1. Parvalbumin beta
GPLGSMAFAS VLKDAEVTAA LDGCKAAGSF DHKKFFKACG LSGKSTDEVK KAFAIIDQDK SGFIEEEELK LFLQNFKAGA RALSDAETKA FLKAGDSDGD GKIGIDEFAA MIKGSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII HD - 800 MHz migi
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker AvanceIII HD - 800 MHz migi
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Varian UNITY - 500 MHz scorpio
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Varian UNITY - 600 MHz libra
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Varian UNITY - 600 MHz libra
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Varian UNITY - 600 MHz libra
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Varian UNITY - 600 MHz libra
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Varian UNITY - 600 MHz libra
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Varian UNITY - 600 MHz libra
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Varian UNITY - 600 MHz libra
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Varian UNITY - 600 MHz libra
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker AvanceIII HD - 800 MHz migi
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker AvanceIII HD - 800 MHz migi
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker AvanceIII HD - 800 MHz migi
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker AvanceIII HD - 800 MHz migi
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Bruker AvanceIII HD - 800 MHz migi
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Varian UNITY - 500 MHz scorpio
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Varian UNITY - 500 MHz scorpio
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.5 mM [U-13C; U-15N] Sco j 1, 7 % [U-2H] D2O, 20 mM MES, 150 mM sodium chloride, 10 mM CaCl2, 93% H2O/7% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Sco j 1 | [U-13C; U-15N] | protein | 0.5 mM |
2 | CaCl2 | natural abundance | salt | 10 mM |
3 | sodium chloride | natural abundance | salt | 150 mM |
4 | MES | natural abundance | buffer | 20 mM |
5 | H2O | natural abundance | solvent | 93 % |
6 | D2O | [U-2H] | solvent | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_36086_5xnd.nef |
Input source #2: Coordindates | 5xnd.cif |
Diamagnetism of the molecular assembly | False (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:57:ASP:OD1 | 2:1:CA:CA | unknown | unknown | n/a |
1:59:ASP:OD1 | 2:1:CA:CA | unknown | unknown | n/a |
1:61:SER:OG | 2:1:CA:CA | unknown | unknown | n/a |
1:63:PHE:O | 2:1:CA:CA | unknown | unknown | n/a |
1:68:GLU:OE1 | 2:1:CA:CA | unknown | unknown | n/a |
1:68:GLU:OE2 | 2:1:CA:CA | unknown | unknown | n/a |
1:96:ASP:OD1 | 2:2:CA:CA | unknown | unknown | n/a |
1:98:ASP:OD1 | 2:2:CA:CA | unknown | unknown | n/a |
1:100:ASP:OD1 | 2:2:CA:CA | unknown | unknown | n/a |
1:102:LYS:O | 2:2:CA:CA | unknown | unknown | n/a |
1:107:GLU:OE1 | 2:2:CA:CA | unknown | unknown | n/a |
1:107:GLU:OE2 | 2:2:CA:CA | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | CA | CALCIUM ION | None |
B | 2 | CA | CALCIUM ION | None |
Sequence alignments
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- GPLGSMAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEEEELKLFLQNFKAGARALSDAETKAFLKAGDSDGD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPLGSMAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEEEELKLFLQNFKAGARALSDAETKAFLKAGDSDGD --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --100--------- GKIGIDEFAAMIKG |||||||||||||| GKIGIDEFAAMIKG -------110----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 114 | 0 | 0 | 100.0 |
Content subtype: combined_36086_5xnd.nef
Assigned chemical shifts
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- GPLGSMAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEEEELKLFLQNFKAGARALSDAETKAFLKAGDSDGD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....SMAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEEEELKLFLQNFKAGARALSDAETKAFLKAGDSDGD --100--------- GKIGIDEFAAMIKG |||||||||||||| GKIGIDEFAAMIKG
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
24 | SER | HG | 6.103 |
53 | GLN | CD | 179.625 |
69 | GLN | CD | 179.584 |
76 | ARG | HH11 | 6.194 |
76 | ARG | CZ | 160.774 |
79 | SER | HG | 6.284 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 655 | 629 | 96.0 |
13C chemical shifts | 498 | 455 | 91.4 |
15N chemical shifts | 117 | 113 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 240 | 228 | 95.0 |
13C chemical shifts | 228 | 218 | 95.6 |
15N chemical shifts | 113 | 109 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 415 | 401 | 96.6 |
13C chemical shifts | 270 | 237 | 87.8 |
15N chemical shifts | 4 | 4 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 59 | 57 | 96.6 |
13C chemical shifts | 59 | 57 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 49 | 94.2 |
13C chemical shifts | 52 | 26 | 50.0 |
Covalent bonds
Distance restraints
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- GPLGSMAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEEEELKLFLQNFKAGARALSDAETKAFLKAGDSDGD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEEEELKLFLQNFKAGARALSDAETKAFLKAGDSDGD --100--------- GKIGIDEFAAMIKG |||||||||||||| GKIGIDEFAAMIKG
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- GPLGSMAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEEEELKLFLQNFKAGARALSDAETKAFLKAGDSDGD |||| |||| ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||| |||||||||||||||||| || .....MAFA.VLKD.EVTAALDGCKAAGSFDHKKFFKACGLS.KSTDEVKKAFAIIDQDKSGFIEEEELKLFLQNFKA.ARALSDAETKAFLKAGDS.GD -------------10--------20--------30--------40--------50--------60--------70--------80--------90----- --100--------- GKIGIDEFAAMIKG ||||||||||||| GKIGIDEFAAMIK --100--------
Dihedral angle restraints
-------------10--------20--------30--------40--------50--------60--------70--------80--------90----- GPLGSMAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIEEEELKLFLQNFKAGARALSDAETKAFLKAGDSDGD ||||||||||||||||||||| ||||||||||||||| |||||||||||||||||||||||||||||||||||||| |||||||||||||||||| .....MAFASVLKDAEVTAALDGCKA.GSFDHKKFFKACGLS.KSTDEVKKAFAIIDQDKSGFIEEEELKLFLQNFKAGAR.LSDAETKAFLKAGDSDGD --100--------- GKIGIDEFAAMIKG |||||||||||||| GKIGIDEFAAMIKG