Solution structure of LysM domain from a chitinase derived from Volvox carteri
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS3:SG | 1:CYS49:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.4 % (531 of 551) | 94.7 % (268 of 283) | 98.1 % (211 of 215) | 98.1 % (52 of 53) |
Backbone | 99.0 % (283 of 286) | 98.0 % (97 of 99) | 100.0 % (142 of 142) | 97.8 % (44 of 45) |
Sidechain | 94.5 % (292 of 309) | 92.9 % (171 of 184) | 96.6 % (113 of 117) | 100.0 % (8 of 8) |
Aromatic | 73.3 % (22 of 30) | 73.3 % (11 of 15) | 71.4 % (10 of 14) | 100.0 % (1 of 1) |
Methyl | 100.0 % (68 of 68) | 100.0 % (34 of 34) | 100.0 % (34 of 34) |
1. entity 1
MGCTYTIQPG DTFWAIAQRR GTTVDVIQSL NPGVVPTRLQ VGQVINVPCSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 189 K, pH 5.0, Details 360 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LysM | [U-13C; U-15N] | protein | 360 uM |
2 | sodium acetate | [U-2H] | buffer | 20 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 189 K, pH 5.0, Details 267 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | LysM | [U-13C; U-15N] | protein | 267 uM |
6 | sodium acetate | [U-2H] | buffer | 20 mM |
7 | D2O | [U-2H] | solvent | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 14.7 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | water | protons | 36.5 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 14.7 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | water | protons | 36.5 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 14.7 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | water | protons | 36.5 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 14.7 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.7 ppm | internal | direct | 1.0 |
15N | water | protons | 36.5 ppm | internal | indirect | 0.1013291 |
Bruker AvanceIII - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 189 K, pH 5.0, Details 267 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | LysM | [U-13C; U-15N] | protein | 267 uM |
6 | sodium acetate | [U-2H] | buffer | 20 mM |
7 | D2O | [U-2H] | solvent | 100 % |
Bruker AvanceIII - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 189 K, pH 5.0, Details 267 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | LysM | [U-13C; U-15N] | protein | 267 uM |
6 | sodium acetate | [U-2H] | buffer | 20 mM |
7 | D2O | [U-2H] | solvent | 100 % |
Bruker AvanceIII - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 189 K, pH 5.0, Details 267 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | LysM | [U-13C; U-15N] | protein | 267 uM |
6 | sodium acetate | [U-2H] | buffer | 20 mM |
7 | D2O | [U-2H] | solvent | 100 % |
Bruker AvanceIII - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 189 K, pH 5.0, Details 267 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | LysM | [U-13C; U-15N] | protein | 267 uM |
6 | sodium acetate | [U-2H] | buffer | 20 mM |
7 | D2O | [U-2H] | solvent | 100 % |
Bruker AvanceIII - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 189 K, pH 5.0, Details 267 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | LysM | [U-13C; U-15N] | protein | 267 uM |
6 | sodium acetate | [U-2H] | buffer | 20 mM |
7 | D2O | [U-2H] | solvent | 100 % |
Bruker AvanceIII - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 5.0, Details 360 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LysM | [U-13C; U-15N] | protein | 360 uM |
2 | sodium acetate | [U-2H] | buffer | 20 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 189 K, pH 5.0, Details 267 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | LysM | [U-13C; U-15N] | protein | 267 uM |
6 | sodium acetate | [U-2H] | buffer | 20 mM |
7 | D2O | [U-2H] | solvent | 100 % |
Bruker AvanceIII - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 189 K, pH 5.0, Details 267 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | LysM | [U-13C; U-15N] | protein | 267 uM |
6 | sodium acetate | [U-2H] | buffer | 20 mM |
7 | D2O | [U-2H] | solvent | 100 % |
Bruker AvanceIII - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 5.0, Details 360 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LysM | [U-13C; U-15N] | protein | 360 uM |
2 | sodium acetate | [U-2H] | buffer | 20 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 5.0, Details 360 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LysM | [U-13C; U-15N] | protein | 360 uM |
2 | sodium acetate | [U-2H] | buffer | 20 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 5.0, Details 360 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LysM | [U-13C; U-15N] | protein | 360 uM |
2 | sodium acetate | [U-2H] | buffer | 20 mM |
3 | H2O | natural abundance | solvent | 90 % |
4 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 189 K, pH 5.0, Details 267 uM [U-13C; U-15N] LysM, 20 mM [U-2H] sodium acetate, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | LysM | [U-13C; U-15N] | protein | 267 uM |
6 | sodium acetate | [U-2H] | buffer | 20 mM |
7 | D2O | [U-2H] | solvent | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_36142_5yz6.nef |
Input source #2: Coordindates | 5yz6.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:21:CYS:SG | A:67:CYS:SG | oxidized, CA 56.324, CB 42.753 ppm | oxidized, CA 52.979, CB 38.992 ppm | 2.008 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-20-------30--------40--------50--------60------- MGCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVVPTRLQVGQVINVPC ||||||||||||||||||||||||||||||||||||||||||||||||| MGCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVVPTRLQVGQVINVPC --------10--------20--------30--------40---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 49 | 0 | 0 | 100.0 |
Content subtype: combined_36142_5yz6.nef
Assigned chemical shifts
-20-------30--------40--------50--------60------- MGCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVVPTRLQVGQVINVPC ||||||||||||||||||||||||||||||||||||||||||||||||| MGCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVVPTRLQVGQVINVPC
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
30 | THR | HG1 | 5.594 |
40 | THR | HG1 | 6.296 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 283 | 267 | 94.3 |
13C chemical shifts | 215 | 210 | 97.7 |
15N chemical shifts | 56 | 55 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 99 | 97 | 98.0 |
13C chemical shifts | 98 | 98 | 100.0 |
15N chemical shifts | 45 | 44 | 97.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 184 | 170 | 92.4 |
13C chemical shifts | 117 | 112 | 95.7 |
15N chemical shifts | 11 | 11 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 34 | 97.1 |
13C chemical shifts | 35 | 34 | 97.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 15 | 11 | 73.3 |
13C chemical shifts | 14 | 10 | 71.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
-20-------30--------40--------50--------60------- MGCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVVPTRLQVGQVINVPC | | || |||| ||| | |||||||||| || ||| ..C.Y.IQ..DTFW.IAQ.R.TTVDVIQSLN..........GQ.INV -20-------30--------40--------50--------60-----
-20-------30--------40--------50--------60------- MGCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVVPTRLQVGQVINVPC | | || |||| ||| | |||||||||| || ||| ..C.Y.IQ..DTFW.IAQ.R.TTVDVIQSLN..........GQ.INV -20-------30--------40--------50--------60-----
Dihedral angle restraints