Solution structure of the N-terminal domain of the anti-sigma factor RsgI1 from Clostridium thermocellum
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.5 % (642 of 652) | 98.5 % (337 of 342) | 98.8 % (243 of 246) | 96.9 % (62 of 64) |
Backbone | 97.5 % (310 of 318) | 97.3 % (108 of 111) | 98.1 % (151 of 154) | 96.2 % (51 of 53) |
Sidechain | 99.2 % (379 of 382) | 99.1 % (229 of 231) | 99.3 % (139 of 140) | 100.0 % (11 of 11) |
Aromatic | 100.0 % (36 of 36) | 100.0 % (18 of 18) | 100.0 % (18 of 18) | |
Methyl | 100.0 % (60 of 60) | 100.0 % (30 of 30) | 100.0 % (30 of 30) |
1. entity 1
SMNRLGIIYE IQGMKAVVLT SEGEFLIIRR RKDMKVGQQV SFENEDIYNV RGKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.2, Details 1.0 mM [U-13C; U-15N] RsgI1 N-terminal domain, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1 N-terminal domain | [U-13C; U-15N] | protein | 1.0 mM |
2 | Bis-Tris | natural abundance | buffer | 20 mM |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium chloride | natural abundance | salt | 50 mM |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr36220_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--- SMNRLGIIYEIQGMKAVVLTSEGEFLIIRRRKDMKVGQQVSFENEDIYNVRGK |||||||||||||||||||||||||||||||||||||||||||||||||||| .MNRLGIIYEIQGMKAVVLTSEGEFLIIRRRKDMKVGQQVSFENEDIYNVRGK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 342 | 337 | 98.5 |
13C chemical shifts | 246 | 243 | 98.8 |
15N chemical shifts | 64 | 62 | 96.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 111 | 108 | 97.3 |
13C chemical shifts | 106 | 104 | 98.1 |
15N chemical shifts | 53 | 51 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 231 | 229 | 99.1 |
13C chemical shifts | 140 | 139 | 99.3 |
15N chemical shifts | 11 | 11 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 33 | 100.0 |
13C chemical shifts | 33 | 33 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 18 | 18 | 100.0 |
13C chemical shifts | 18 | 18 | 100.0 |