Solution structure of the Sigma-anti-sigma factor complex RsgI1N-SigI1C from Clostridium thermocellum
MEDIEAREDI EELKKKLQEF GITFLDLVLN VPKHRDSRQL CIRLAKMLAE DEQMYNALMK NKNIPRNELK KKAKVHGRTI GNNRKYIIAL CLIFRSNLNL SKRYLEYYTM LEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.6 % (2031 of 2148) | 94.0 % (1062 of 1130) | 96.0 % (784 of 817) | 92.0 % (185 of 201) |
Backbone | 94.6 % (967 of 1022) | 92.5 % (322 of 348) | 96.4 % (487 of 505) | 93.5 % (158 of 169) |
Sidechain | 94.7 % (1221 of 1289) | 94.6 % (740 of 782) | 95.6 % (454 of 475) | 84.4 % (27 of 32) |
Aromatic | 79.7 % (110 of 138) | 79.7 % (55 of 69) | 79.7 % (55 of 69) | |
Methyl | 100.0 % (190 of 190) | 100.0 % (95 of 95) | 100.0 % (95 of 95) |
1. entity 1
SMNRLGIIYE IQGMKAVVLT SEGEFLIIRR RKDMKVGQQV SFENEDIYNV RGK2. entity 2
MEDIEAREDI EELKKKLQEF GITFLDLVLN VPKHRDSRQL CIRLAKMLAE DEQMYNALMK NKNIPRNELK KKAKVHGRTI GNNRKYIIAL CLIFRSNLNL SKRYLEYYTM LEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 1 mM [U-13C; U-15N] RsgI1N, 1 mM [U-13C; U-15N] SigI1C, 20 mM Bis-Tris, 50 mM sodium chloride, 2 mM EDTA, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RsgI1N | [U-13C; U-15N] | protein | 1 mM |
2 | SigI1C | [U-13C; U-15N] | protein | 1 mM |
3 | Bis-Tris | natural abundance | buffer | 20 mM |
4 | EDTA | natural abundance | 2 mM | |
5 | sodium chloride | natural abundance | salt | 50 mM |
6 | H2O | natural abundance | solvent | 90 % |
7 | D2O | [U-2H] | solvent | 10 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr36221_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--- SMNRLGIIYEIQGMKAVVLTSEGEFLIIRRRKDMKVGQQVSFENEDIYNVRGK |||||||||||||||||||||||||||||||||||||||||||||||||||| .MNRLGIIYEIQGMKAVVLTSEGEFLIIRRRKDMKVGQQVSFENEDIYNVRGK
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEDIEAREDIEELKKKLQEFGITFLDLVLNVPKHRDSRQLCIRLAKMLAEDEQMYNALMKNKNIPRNELKKKAKVHGRTIGNNRKYIIALCLIFRSNLNL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||| .EDIEAREDIEELKKKLQEFGITFLDLVLNVPKHRDSRQLCIRLAKMLAEDEQMYNALMKNKNIPRNELKKKAKVH.RTIGNNRKYIIALCLIFRSNLNL -------110-------- SKRYLEYYTMLEHHHHHH |||||||||||| || SKRYLEYYTMLE....HH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 342 | 335 | 98.0 |
13C chemical shifts | 246 | 242 | 98.4 |
15N chemical shifts | 64 | 61 | 95.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 111 | 108 | 97.3 |
13C chemical shifts | 106 | 104 | 98.1 |
15N chemical shifts | 53 | 51 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 231 | 227 | 98.3 |
13C chemical shifts | 140 | 138 | 98.6 |
15N chemical shifts | 11 | 10 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 33 | 100.0 |
13C chemical shifts | 33 | 33 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 18 | 17 | 94.4 |
13C chemical shifts | 18 | 17 | 94.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 788 | 741 | 94.0 |
13C chemical shifts | 571 | 539 | 94.4 |
15N chemical shifts | 137 | 123 | 89.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 237 | 220 | 92.8 |
13C chemical shifts | 236 | 224 | 94.9 |
15N chemical shifts | 116 | 106 | 91.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 551 | 521 | 94.6 |
13C chemical shifts | 335 | 315 | 94.0 |
15N chemical shifts | 21 | 17 | 81.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 69 | 98.6 |
13C chemical shifts | 70 | 69 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 51 | 38 | 74.5 |
13C chemical shifts | 51 | 38 | 74.5 |