Solution structure of Taf14ET-Sth1EBMC
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.9 % (1390 of 1563) | 89.1 % (732 of 822) | 89.0 % (535 of 601) | 87.9 % (123 of 140) |
Backbone | 90.4 % (707 of 782) | 89.5 % (238 of 266) | 92.0 % (358 of 389) | 87.4 % (111 of 127) |
Sidechain | 88.3 % (800 of 906) | 88.8 % (494 of 556) | 87.2 % (294 of 337) | 92.3 % (12 of 13) |
Aromatic | 58.9 % (33 of 56) | 71.4 % (20 of 28) | 44.4 % (12 of 27) | 100.0 % (1 of 1) |
Methyl | 95.3 % (141 of 148) | 97.3 % (72 of 74) | 93.2 % (69 of 74) |
1. Transcription initiation factor TFIID subunit 14
SKGSVDLEKL AFGLTKLNED DLVGVVQMVT DNKTPEMNVT NNVEEGEFII DLYSLPEGLL KSLWDYVKKN TE2. Nuclear protein STH1/NPS1
SEVKSSSVEI INGSESKKKK PKLTVKIKLN KTTVLENNDG KRAEEKPESK SPAKKTAAKYSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Agilent DD2 - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0, Details 1 mM [U-100% 13C; U-100% 15N] Taf14ET, 1.5 mM [U-100% 13C; U-100% 15N] Sth1EBMC, 20 mM Phosphate buffer, 100 mM sodium chloride, 1 % v/v inhabitor cocktail, 0.04 % sodium azide, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Phosphate buffer | natural abundance | buffer | 20 mM |
2 | Sth1EBMC | [U-100% 13C; U-100% 15N] | protein | 1.5 mM |
3 | Taf14ET | [U-100% 13C; U-100% 15N] | protein | 1 mM |
4 | inhabitor cocktail | natural abundance | 1 % v/v | |
5 | sodium azide | natural abundance | 0.04 % | |
6 | sodium chloride | natural abundance | salt | 100 mM |
7 | H2O | natural abundance | solvent | 90 % |
8 | D2O | [U-2H] | solvent | 10 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr36309_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70-- SKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYSLPEGLLKSLWDYVKKNTE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .KGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYSLPEGLLKSLWDYVKKNTE
--------10--------20--------30--------40--------50--------60 SEVKSSSVEIINGSESKKKKPKLTVKIKLNKTTVLENNDGKRAEEKPESKSPAKKTAAKY |||||| ||| ||| ||||||||||||||||||||||||||||||||||||||| ..VKSSSV..ING.ESK...PKLTVKIKLNKTTVLENNDGKRAEEKPESKSPAKKTAAK --------10--------20--------30--------40--------50---------
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
15 | THR | HG1 | 5.916 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 436 | 426 | 97.7 |
13C chemical shifts | 329 | 314 | 95.4 |
15N chemical shifts | 78 | 76 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 147 | 143 | 97.3 |
13C chemical shifts | 144 | 141 | 97.9 |
15N chemical shifts | 70 | 68 | 97.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 289 | 283 | 97.9 |
13C chemical shifts | 185 | 173 | 93.5 |
15N chemical shifts | 8 | 8 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 48 | 100.0 |
13C chemical shifts | 48 | 48 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 24 | 20 | 83.3 |
13C chemical shifts | 23 | 12 | 52.2 |
15N chemical shifts | 1 | 1 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 386 | 304 | 78.8 |
13C chemical shifts | 272 | 216 | 79.4 |
15N chemical shifts | 62 | 45 | 72.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 119 | 93 | 78.2 |
13C chemical shifts | 120 | 97 | 80.8 |
15N chemical shifts | 57 | 41 | 71.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 267 | 211 | 79.0 |
13C chemical shifts | 152 | 119 | 78.3 |
15N chemical shifts | 5 | 4 | 80.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 28 | 26 | 92.9 |
13C chemical shifts | 28 | 23 | 82.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 4 | 0 | 0.0 |
13C chemical shifts | 4 | 0 | 0.0 |