Solution structure of RPB6, common subunit of RNA polymerases I, II, and III
GSHMSDNEDN FDGDDFDDVE EDEGLDDLEN AEEEGQENVE ILPSGERPQA NQKRITTPYM TKYERARVLG TRALQIAMCA PVMVELEGET DPLLIAMKEL KARKIPIIIR RYLPDGSYED WGVDELIITD
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.3 % (1372 of 1487) | 88.9 % (688 of 774) | 95.8 % (548 of 572) | 96.5 % (136 of 141) |
Backbone | 96.6 % (740 of 766) | 94.3 % (247 of 262) | 97.9 % (373 of 381) | 97.6 % (120 of 123) |
Sidechain | 89.2 % (751 of 842) | 86.1 % (441 of 512) | 94.2 % (294 of 312) | 88.9 % (16 of 18) |
Aromatic | 58.8 % (40 of 68) | 58.8 % (20 of 34) | 57.6 % (19 of 33) | 100.0 % (1 of 1) |
Methyl | 94.9 % (129 of 136) | 91.2 % (62 of 68) | 98.5 % (67 of 68) |
1. DNA-directed RNA polymerases I, II, and III subunit RPABC2
GSHMSDNEDN FDGDDFDDVE EDEGLDDLEN AEEEGQENVE ILPSGERPQA NQKRITTPYM TKYERARVLG TRALQIAMCA PVMVELEGET DPLLIAMKEL KARKIPIIIR RYLPDGSYED WGVDELIITDSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
8 | potassium phosphate | natural abundance | buffer | 20 mM |
9 | NaCl | natural abundance | salt | 25 mM |
10 | d-DTT | [U-2H] | 5 mM | |
11 | D2O | [U-2H] | solvent | 100 % |
Pressure 1 atm, Temperature 298 K, pH 6.8
Experiment name 2D 1H-15N HSQC
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
8 | potassium phosphate | natural abundance | buffer | 20 mM |
9 | NaCl | natural abundance | salt | 25 mM |
10 | d-DTT | [U-2H] | 5 mM | |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker AVANCE III HD - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
8 | potassium phosphate | natural abundance | buffer | 20 mM |
9 | NaCl | natural abundance | salt | 25 mM |
10 | d-DTT | [U-2H] | 5 mM | |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
8 | potassium phosphate | natural abundance | buffer | 20 mM |
9 | NaCl | natural abundance | salt | 25 mM |
10 | d-DTT | [U-2H] | 5 mM | |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
8 | potassium phosphate | natural abundance | buffer | 20 mM |
9 | NaCl | natural abundance | salt | 25 mM |
10 | d-DTT | [U-2H] | 5 mM | |
11 | D2O | [U-2H] | solvent | 100 % |
Bruker AVANCE III HD - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
2 | potassium phosphate | natural abundance | buffer | 20 mM |
3 | NaCl | natural abundance | salt | 25 mM |
4 | d-DTT | [U-2H] | 5 mM | |
5 | H2O | natural abundance | solvent | 90 % |
6 | D2O | [U-2H] | solvent | 10 % |
Bruker AVANCE III HD - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 2.0 mM [U-100% 13C; U-100% 15N] RPB6, 100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | RPB6 | [U-100% 13C; U-100% 15N] | protein | 2.0 mM |
8 | potassium phosphate | natural abundance | buffer | 20 mM |
9 | NaCl | natural abundance | salt | 25 mM |
10 | d-DTT | [U-2H] | 5 mM | |
11 | D2O | [U-2H] | solvent | 100 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr36405_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSHMSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKEL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKEL -------110-------120-------130 KARKIPIIIRRYLPDGSYEDWGVDELIITD |||||||||||||||||||||||||||||| KARKIPIIIRRYLPDGSYEDWGVDELIITD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 774 | 691 | 89.3 |
13C chemical shifts | 572 | 548 | 95.8 |
15N chemical shifts | 141 | 136 | 96.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 262 | 251 | 95.8 |
13C chemical shifts | 260 | 254 | 97.7 |
15N chemical shifts | 123 | 120 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 512 | 440 | 85.9 |
13C chemical shifts | 312 | 294 | 94.2 |
15N chemical shifts | 18 | 16 | 88.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 67 | 91.8 |
13C chemical shifts | 73 | 71 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 20 | 58.8 |
13C chemical shifts | 33 | 19 | 57.6 |
15N chemical shifts | 1 | 1 | 100.0 |