Complete 1H, 13C and 15N resonance assignments of Blo t 5, a major mite allergen from Blomia tropicalis.
GSQEHKPKKD DFRNEFDHLL IEQANHAIEK GEHQLLYLQH QLDELNENKS KELQEKIIRE LDVVCAMIEG AQGALERELK RTDLNILERF NYEEAQTLSK ILLKDLKETE QKVKDIQTQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 99.4 % (1457 of 1466) | 99.1 % (771 of 778) | 99.8 % (552 of 553) | 99.3 % (134 of 135) |
Backbone | 99.7 % (710 of 712) | 99.6 % (240 of 241) | 100.0 % (353 of 353) | 99.2 % (117 of 118) |
Sidechain | 99.2 % (862 of 869) | 98.9 % (531 of 537) | 99.7 % (314 of 315) | 100.0 % (17 of 17) |
Aromatic | 97.0 % (64 of 66) | 97.0 % (32 of 33) | 97.0 % (32 of 33) | |
Methyl | 100.0 % (132 of 132) | 100.0 % (66 of 66) | 100.0 % (66 of 66) |
1. Blo t 5
GSQEHKPKKD DFRNEFDHLL IEQANHAIEK GEHQLLYLQH QLDELNENKS KELQEKIIRE LDVVCAMIEG AQGALERELK RTDLNILERF NYEEAQTLSK ILLKDLKETE QKVKDIQTQTemperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Blo t 5 | [U-15N] | protein | 1 (±0.05) mM |
7 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
8 | Sodium Chloride | salt | 100 (±0.01) mM | |
9 | EDTA | chelating agent | 2 (±0.01) mM | |
10 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Blo t 5 | protein | 1 (±0.05) mM | |
12 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
13 | Sodium Chloride | salt | 100 (±0.01) mM | |
14 | EDTA | chelating agent | 2 (±0.01) mM | |
15 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 10% 13C Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | Blo t 5 | [U-10% 13C] | protein | 0.8 (±0.05) mM |
17 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
18 | Sodium Chloride | salt | 100 (±0.01) mM | |
19 | EDTA | chelating agent | 2 (±0.01) mM | |
20 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Blo t 5 | [U-15N] | protein | 1 (±0.05) mM |
7 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
8 | Sodium Chloride | salt | 100 (±0.01) mM | |
9 | EDTA | chelating agent | 2 (±0.01) mM | |
10 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 500 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 500 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 500 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 500 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 800 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 500 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Blo t 5 | protein | 1 (±0.05) mM | |
12 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
13 | Sodium Chloride | salt | 100 (±0.01) mM | |
14 | EDTA | chelating agent | 2 (±0.01) mM | |
15 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 500 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Blo t 5 | protein | 1 (±0.05) mM | |
12 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
13 | Sodium Chloride | salt | 100 (±0.01) mM | |
14 | EDTA | chelating agent | 2 (±0.01) mM | |
15 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 500 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | Blo t 5 | protein | 1 (±0.05) mM | |
12 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
13 | Sodium Chloride | salt | 100 (±0.01) mM | |
14 | EDTA | chelating agent | 2 (±0.01) mM | |
15 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 800 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 800 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Blo t 5 | [U-15N] | protein | 1 (±0.05) mM |
7 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
8 | Sodium Chloride | salt | 100 (±0.01) mM | |
9 | EDTA | chelating agent | 2 (±0.01) mM | |
10 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Blo t 5 | [U-15N] | protein | 1 (±0.05) mM |
7 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
8 | Sodium Chloride | salt | 100 (±0.01) mM | |
9 | EDTA | chelating agent | 2 (±0.01) mM | |
10 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 13C, 15N Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Blo t 5 | [U-13C; U-15N] | protein | 1 (±0.05) mM |
2 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
3 | Sodium Chloride | salt | 100 (±0.01) mM | |
4 | EDTA | chelating agent | 2 (±0.01) mM | |
5 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Bruker Avance - 600 MHz
State isotropic, Temperature 295 (±0.1) K, pH 7.5 (±0.01), Details 10% 13C Blo t 5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | Blo t 5 | [U-10% 13C] | protein | 0.8 (±0.05) mM |
17 | Potassium Phosphate | buffer | 50 (±0.01) mM | |
18 | Sodium Chloride | salt | 100 (±0.01) mM | |
19 | EDTA | chelating agent | 2 (±0.01) mM | |
20 | Sodium Azide | antimicrobial agent | 0.001 (±1.0E-4) % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_7276_2mey.nef |
Input source #2: Coordindates | 2mey.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GSQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 00-------110------- ILLKDLKETEQKVKDIQTQ ||||||||||||||||||| ILLKDLKETEQKVKDIQTQ -------110---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 119 | 0 | 0 | 100.0 |
Content subtype: combined_7276_2mey.nef
Assigned chemical shifts
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GSQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSK 00-------110------- ILLKDLKETEQKVKDIQTQ ||||||||||||||||||| ILLKDLKETEQKVKDIQTQ
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
1 | GLN | CD | 179.139 |
2 | GLU | CD | 183.87 |
3 | HIS | ND1 | 187.624 |
3 | HIS | NE2 | 181.012 |
8 | ASP | CG | 178.458 |
9 | ASP | CG | 171.079 |
12 | ASN | CG | 176.953 |
13 | GLU | CD | 183.871 |
15 | ASP | CG | 180.359 |
16 | HIS | ND1 | 204.739 |
16 | HIS | NE2 | 178.782 |
20 | GLU | CD | 183.698 |
21 | GLN | CD | 179.779 |
23 | ASN | CG | 175.356 |
24 | HIS | ND1 | 202.18 |
24 | HIS | NE2 | 186.448 |
27 | GLU | CD | 182.83 |
30 | GLU | CD | 182.83 |
31 | HIS | ND1 | 212.259 |
31 | HIS | NE2 | 178.642 |
32 | GLN | CD | 178.656 |
37 | GLN | CD | 179.566 |
38 | HIS | ND1 | 193.341 |
38 | HIS | NE2 | 178.949 |
39 | GLN | CD | 180.772 |
41 | ASP | CG | 179.242 |
42 | GLU | CD | 183.945 |
44 | ASN | CG | 176.151 |
45 | GLU | CD | 182.064 |
46 | ASN | CG | 175.834 |
50 | GLU | CD | 183.924 |
52 | GLN | CD | 178.985 |
53 | GLU | CD | 183.396 |
58 | GLU | CD | 183.897 |
60 | ASP | CG | 178.88 |
67 | GLU | CD | 183.393 |
70 | GLN | CD | 179.069 |
74 | GLU | CD | 183.585 |
76 | GLU | CD | 183.887 |
81 | ASP | CG | 178.731 |
83 | ASN | CG | 176.095 |
86 | GLU | CD | 183.509 |
89 | ASN | CG | 175.37 |
91 | GLU | CD | 183.434 |
92 | GLU | CD | 183.863 |
94 | GLN | CD | 178.729 |
103 | ASP | CG | 178.214 |
106 | GLU | CD | 183.828 |
108 | GLU | CD | 183.811 |
109 | GLN | CD | 180.69 |
113 | ASP | CG | 178.752 |
115 | GLN | CD | 180.571 |
117 | GLN | CD | 181.429 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 778 | 769 | 98.8 |
13C chemical shifts | 553 | 552 | 99.8 |
15N chemical shifts | 140 | 132 | 94.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 241 | 238 | 98.8 |
13C chemical shifts | 238 | 238 | 100.0 |
15N chemical shifts | 118 | 115 | 97.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 537 | 531 | 98.9 |
13C chemical shifts | 315 | 314 | 99.7 |
15N chemical shifts | 22 | 17 | 77.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 67 | 67 | 100.0 |
13C chemical shifts | 67 | 67 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 33 | 32 | 97.0 |
13C chemical shifts | 33 | 32 | 97.0 |
Distance restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GSQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSK |||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||| ..QEHKPKKDDFRNEF..LLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRT.LNILERFNYEEAQTLSK 00-------110------- ILLKDLKETEQKVKDIQTQ ||||||||||||||||||| ILLKDLKETEQKVKDIQTQ
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GSQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSK |||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| |||||||||||||||| ..................LLIEQANHAIEKGEHQLLYLQHQLDELN.NKSKELQEKIIRELDVVCAMIEGAQGALERELK....NILERFNYEEAQTLSK -0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 00-------110------- ILLKDLKETEQKVKDIQTQ |||||||||||||||| ILLKDLKETEQKVKDI 00-------110----
Dihedral angle restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GSQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSK ||| ||| ||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||| ....HKP..DDF...FDH.LIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRT..NILERFNYEEAQTLSK 00-------110------- ILLKDLKETEQKVKDIQTQ ||||||||||||||| ||| ILLKDLKETEQKVKD.QTQ
RDC restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GSQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSK | |||| | | || || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||| |||||||||||| ..Q.HKPK..D.R.EF.HL...QANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKR.DLNIL.RFNYEEAQTLSK 00-------110------- ILLKDLKETEQKVKDIQTQ ||||||||||||||||||| ILLKDLKETEQKVKDIQTQ