1H, 13C and 15N resonance assignments of the 2'-5' RNA ligase-like protein from Pyrococcus furiosus
MRAFIAIDVS ESVRDALVRA QDYIGSKEAK IKFVERENFH ITLKFLGEIT EEQAEEIKKI LEKIAKKYKK HEVNVRGIGV FPNPNYVRVI WAGVENDEII KKIAKEIDDE LAKLGFKKEG NFVAHITLGR VKFVKDKLGL AMKLKELANE DFGSFIVEAI ELKKSTLTPK GPIYETLARF ELSEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.9 % (2285 of 2334) | 97.9 % (1195 of 1221) | 97.9 % (898 of 917) | 98.0 % (192 of 196) |
Backbone | 98.9 % (1120 of 1132) | 99.0 % (383 of 387) | 99.1 % (554 of 559) | 98.4 % (183 of 186) |
Sidechain | 97.3 % (1344 of 1381) | 97.4 % (812 of 834) | 97.4 % (523 of 537) | 90.0 % (9 of 10) |
Aromatic | 85.3 % (162 of 190) | 86.3 % (82 of 95) | 85.1 % (80 of 94) | 0.0 % (0 of 1) |
Methyl | 100.0 % (234 of 234) | 100.0 % (117 of 117) | 100.0 % (117 of 117) |
1. 2'-5' RNA ligase-like protein
MRAFIAIDVS ESVRDALVRA QDYIGSKEAK IKFVERENFH ITLKFLGEIT EEQAEEIKKI LEKIAKKYKK HEVNVRGIGV FPNPNYVRVI WAGVENDEII KKIAKEIDDE LAKLGFKKEG NFVAHITLGR VKFVKDKLGL AMKLKELANE DFGSFIVEAI ELKKSTLTPK GPIYETLARF ELSEHHHHHHTemperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker AVANCE - 700 MHz
State isotropic, Temperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Bruker AVANCE - 700 MHz
State isotropic, Temperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Bruker AVANCE - 700 MHz
State isotropic, Temperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Bruker AVANCE - 700 MHz
State isotropic, Temperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Bruker AVANCE - 700 MHz
State isotropic, Temperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Bruker AVANCE - 700 MHz
State isotropic, Temperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Bruker AVANCE - 700 MHz
State isotropic, Temperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Bruker AVANCE - 700 MHz
State isotropic, Temperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Bruker AVANCE - 700 MHz
State isotropic, Temperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Bruker AVANCE - 700 MHz
State isotropic, Temperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Bruker AVANCE - 700 MHz
State isotropic, Temperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Bruker AVANCE - 700 MHz
State isotropic, Temperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Bruker AVANCE - 700 MHz
State isotropic, Temperature 313 (±0.1) K, pH 4.7 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 2'-5' RNA ligase-like protein | [U-13C; U-15N] | 1.1 (±0.1) mM | |
2 | hydrochloric acid | 1.0 (±0.1) mM | ||
3 | sodium chloride | 200 (±0.1) mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr10004_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRAFIAIDVSESVRDALVRAQDYIGSKEAKIKFVERENFHITLKFLGEITEEQAEEIKKILEKIAKKYKKHEVNVRGIGVFPNPNYVRVIWAGVENDEII |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRAFIAIDVSESVRDALVRAQDYIGSKEAKIKFVERENFHITLKFLGEITEEQAEEIKKILEKIAKKYKKHEVNVRGIGVFPNPNYVRVIWAGVENDEII -------110-------120-------130-------140-------150-------160-------170-------180-------190 KKIAKEIDDELAKLGFKKEGNFVAHITLGRVKFVKDKLGLAMKLKELANEDFGSFIVEAIELKKSTLTPKGPIYETLARFELSEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| KKIAKEIDDELAKLGFKKEGNFVAHITLGRVKFVKDKLGLAMKLKELANEDFGSFIVEAIELKKSTLTPKGPIYETLARFELSEHHHHHH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
10 | SER | HG | 5.324 |
12 | SER | HG | 5.293 |
165 | SER | HG | 5.558 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1221 | 1199 | 98.2 |
13C chemical shifts | 917 | 898 | 97.9 |
15N chemical shifts | 204 | 192 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 387 | 385 | 99.5 |
13C chemical shifts | 380 | 375 | 98.7 |
15N chemical shifts | 186 | 183 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 834 | 814 | 97.6 |
13C chemical shifts | 537 | 523 | 97.4 |
15N chemical shifts | 18 | 9 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 119 | 119 | 100.0 |
13C chemical shifts | 119 | 119 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 95 | 81 | 85.3 |
13C chemical shifts | 94 | 80 | 85.1 |
15N chemical shifts | 1 | 0 | 0.0 |