Sequence-Specific 1H, 13C and 15N Resonance Assignments of the Cyclic Nucleotide Binding Domain from a Cyclic Nucleotide-Gated Potassium Channel in Complex with cAMP
GSQEVRRGDF VRNWQLVAAV PLFQKLGPAV LVEIVRALRA RTVPAGAVIC RIGEPGDRMF FVVEGSVSVA TPNPVELGPG AFFGEMALIS GEPRSATVSA ATTVSLLSLH SADFQMLCSS SPEIAEIFRK TALERRGAAA SA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.5 % (1493 of 1563) | 94.9 % (761 of 802) | 95.5 % (593 of 621) | 99.3 % (139 of 140) |
Backbone | 98.4 % (821 of 834) | 98.6 % (283 of 287) | 98.1 % (406 of 414) | 99.2 % (132 of 133) |
Sidechain | 93.4 % (802 of 859) | 92.8 % (478 of 515) | 94.1 % (317 of 337) | 100.0 % (7 of 7) |
Aromatic | 68.8 % (66 of 96) | 68.8 % (33 of 48) | 68.1 % (32 of 47) | 100.0 % (1 of 1) |
Methyl | 100.0 % (188 of 188) | 100.0 % (94 of 94) | 100.0 % (94 of 94) |
1. MlotiCNBDc
GSQEVRRGDF VRNWQLVAAV PLFQKLGPAV LVEIVRALRA RTVPAGAVIC RIGEPGDRMF FVVEGSVSVA TPNPVELGPG AFFGEMALIS GEPRSATVSA ATTVSLLSLH SADFQMLCSS SPEIAEIFRK TALERRGAAA SASolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MlotiCNBDc | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | cAMP | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v | |
6 | D2O | [U-2H] | 5 % v/v | |
7 | H2O | natural abundance | 95 % v/v |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian Unity_INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MlotiCNBDc | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | cAMP | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v | |
6 | D2O | [U-2H] | 5 % v/v | |
7 | H2O | natural abundance | 95 % v/v |
Varian Unity_INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MlotiCNBDc | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | cAMP | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v | |
6 | D2O | [U-2H] | 5 % v/v | |
7 | H2O | natural abundance | 95 % v/v |
Varian Unity_INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MlotiCNBDc | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | cAMP | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v | |
6 | D2O | [U-2H] | 5 % v/v | |
7 | H2O | natural abundance | 95 % v/v |
Varian Unity_INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MlotiCNBDc | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | cAMP | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v | |
6 | D2O | [U-2H] | 5 % v/v | |
7 | H2O | natural abundance | 95 % v/v |
Varian Unity_INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MlotiCNBDc | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | cAMP | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v | |
6 | D2O | [U-2H] | 5 % v/v | |
7 | H2O | natural abundance | 95 % v/v |
Varian Unity_INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MlotiCNBDc | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | cAMP | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v | |
6 | D2O | [U-2H] | 5 % v/v | |
7 | H2O | natural abundance | 95 % v/v |
Varian Unity_INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MlotiCNBDc | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | cAMP | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v | |
6 | D2O | [U-2H] | 5 % v/v | |
7 | H2O | natural abundance | 95 % v/v |
Varian Unity_INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MlotiCNBDc | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | cAMP | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v | |
6 | D2O | [U-2H] | 5 % v/v | |
7 | H2O | natural abundance | 95 % v/v |
Varian Unity_INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MlotiCNBDc | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | cAMP | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v | |
6 | D2O | [U-2H] | 5 % v/v | |
7 | H2O | natural abundance | 95 % v/v |
Varian Unity_INOVA - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MlotiCNBDc | [U-13C; U-15N] | 0.5 mM | |
2 | potassium phosphate | natural abundance | 10 mM | |
3 | potassium chloride | natural abundance | 100 mM | |
4 | cAMP | natural abundance | 0.5 mM | |
5 | sodium azide | natural abundance | 0.02 % v/v | |
6 | D2O | [U-2H] | 5 % v/v | |
7 | H2O | natural abundance | 95 % v/v |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr15249_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSQEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPGAFFGEMALISGEPRSATVSA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSQEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPGAFFGEMALISGEPRSATVSA -------110-------120-------130-------140-- ATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGAAASA |||||||||||||||||||||||||||||||||||||||||| ATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGAAASA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 802 | 762 | 95.0 |
13C chemical shifts | 621 | 589 | 94.8 |
15N chemical shifts | 152 | 139 | 91.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 287 | 283 | 98.6 |
13C chemical shifts | 284 | 272 | 95.8 |
15N chemical shifts | 133 | 130 | 97.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 515 | 479 | 93.0 |
13C chemical shifts | 337 | 317 | 94.1 |
15N chemical shifts | 19 | 9 | 47.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 97 | 97 | 100.0 |
13C chemical shifts | 97 | 97 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 33 | 68.8 |
13C chemical shifts | 47 | 32 | 68.1 |
15N chemical shifts | 1 | 1 | 100.0 |