1H, 13C, and 15N Chemical Shift Assignments for NAB2 N-terminal domain
MSQEQYTENL KVIVAEKLAG IPNFNEDIKY VAEYIVLLIV NGGTVESVVD ELASLFDSVS RDTLANVVQT AFFALEALQQ GESAENIVSK IRMMNAQSLG QSDIA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.8 % (976 of 1193) | 84.4 % (515 of 610) | 75.1 % (349 of 465) | 94.9 % (112 of 118) |
Backbone | 80.1 % (503 of 628) | 87.4 % (187 of 214) | 69.0 % (214 of 310) | 98.1 % (102 of 104) |
Sidechain | 85.7 % (570 of 665) | 83.1 % (329 of 396) | 90.6 % (231 of 255) | 71.4 % (10 of 14) |
Aromatic | 90.6 % (58 of 64) | 90.6 % (29 of 32) | 90.6 % (29 of 32) | |
Methyl | 94.0 % (141 of 150) | 90.7 % (68 of 75) | 97.3 % (73 of 75) |
1. NAB2 NTD
MSQEQYTENL KVIVAEKLAG IPNFNEDIKY VAEYIVLLIV NGGTVESVVD ELASLFDSVS RDTLANVVQT AFFALEALQQ GESAENIVSK IRMMNAQSLG QSDIASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | TSP | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NAB2_NTD | [U-98% 13C; U-98% 15N] | 2 mM | |
2 | D2O | [U-2H] | 10 % | |
3 | H2O | natural abundance | 90 % | |
4 | sodium phosphate | natural abundance | 25 mM | |
5 | sodium chloride | natural abundance | 10 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr15263_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSQEQYTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELASLFDSVSRDTLANVVQTAFFALEALQQGESAENIVSKIRMMNAQSLG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SQEQYTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELASLFDSVSRDTLANVVQTAFFALEALQQGESAENIVSKIRMMNAQSLG ----- QSDIA ||||| QSDIA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 610 | 562 | 92.1 |
13C chemical shifts | 465 | 339 | 72.9 |
15N chemical shifts | 120 | 111 | 92.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 214 | 211 | 98.6 |
13C chemical shifts | 210 | 104 | 49.5 |
15N chemical shifts | 104 | 101 | 97.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 396 | 351 | 88.6 |
13C chemical shifts | 255 | 235 | 92.2 |
15N chemical shifts | 16 | 10 | 62.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 75 | 96.2 |
13C chemical shifts | 78 | 75 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 29 | 90.6 |
13C chemical shifts | 32 | 29 | 90.6 |