Structure and Dynamics of Human Apolipoprotein C-III
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 53.2 % (477 of 896) | 35.7 % (164 of 460) | 67.2 % (236 of 351) | 90.6 % (77 of 85) |
Backbone | 98.7 % (464 of 470) | 96.9 % (154 of 159) | 99.6 % (233 of 234) | 100.0 % (77 of 77) |
Sidechain | 17.7 % (89 of 502) | 3.3 % (10 of 301) | 40.9 % (79 of 193) | 0.0 % (0 of 8) |
Aromatic | 0.0 % (0 of 96) | 0.0 % (0 of 48) | 0.0 % (0 of 45) | 0.0 % (0 of 3) |
Methyl | 13.5 % (10 of 74) | 0.0 % (0 of 37) | 27.0 % (10 of 37) |
1. Apolipoprotein CIII
SEAEDASLLS FMQGYMKHAT KTAKDALSSV QESQVAQQAR GWVTDGFSSL KDYWSTVKDK FSEFWDLDPE VRPTSAVAAPressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle "in 4 % stretched polyacrylamide gel 37.5:1 w/w acrlamide:bisacrylamide"
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
5 | SDS_d25 | [U-2H] | 180 mM | |
6 | Sodium acetate buffer | 50 mM |
Varian INOVA - 600 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 600 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 600 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 600 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 800 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 800 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 600 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 800 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 800 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 600 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 800 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 600 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 800 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 600 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Varian INOVA - 800 MHz Equipped with triple resonance (1H/13C/15N) with XYZ gradient capabilities
State isotropic, Pressure 1 atm, Temperature 315.7 K, pH 5.0, Details SDS-micelle
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Apolipoprotein CIII | [U-13C; U-15N] | 0.5 mM | |
2 | SDS_d25 | [U-2H] | 180 mM | |
3 | Sodium acetate buffer | 10 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_15268_2jq3.nef |
Input source #2: Coordindates | 2jq3.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------- SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 79 | 0 | 0 | 100.0 |
Content subtype: combined_15268_2jq3.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------- SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 351 | 231 | 65.8 |
1H chemical shifts | 460 | 152 | 33.0 |
15N chemical shifts | 87 | 76 | 87.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 158 | 155 | 98.1 |
1H chemical shifts | 159 | 152 | 95.6 |
15N chemical shifts | 77 | 76 | 98.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 193 | 76 | 39.4 |
1H chemical shifts | 301 | 0 | 0.0 |
15N chemical shifts | 10 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 39 | 10 | 25.6 |
1H chemical shifts | 39 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 45 | 0 | 0.0 |
1H chemical shifts | 48 | 0 | 0.0 |
15N chemical shifts | 3 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------- SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||| |||||| .EAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLD.EVR.TSAVAA
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------- SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------- SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA || |||||||||||| ||||||||||| | | |||||||||||||||||||||||||||||||||| ||| |||||| ..AE.ASLLSFMQGYMK.ATKTAKDALSS.Q.S.VAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLD.EVR.TSAVAA