Properties

Disulfide bonds

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Non-standard residues

Content subtype: bmr15286_3.str

Assigned chemical shifts

1. Saveframe: assigned_chem_shift_list_1
   • Status: Warning
   • Sequence coverage of experimental data
     • Entity_assembly_ID: 1, Chain length: 65, Sequence coverage: 100.0%

     --------10--------20--------30--------40--------50--------60-----
     LTCLICPEKDCQKVHTCRNEEKICVKRFYDKNQLGWRAQRGCAVSCPKAKPNETVQCCSTDKCNK
     |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
     LTCLICPEKDCQKVHTCRNEEKICVKRFYDKNQLGWRAQRGCAVSCPKAKPNETVQCCSTDKCNK
     

   • Total number of assignments
     • ¹H chemical shifts: 395
   • Completeness of assignments
     • Entity_assemble_ID: 1
       • Excluded Atom_ID in statistics

         Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
         9	LYS	HZ1	6.77
         9	LYS	HZ2	6.77
         9	LYS	HZ3	6.77
         15	HIS	HD1	7.249
         18	ARG	HH12	7.377
         40	ARG	HH12	6.947
         62	LYS	HZ1	7.384
         62	LYS	HZ2	7.384
         62	LYS	HZ3	7.384

       • All atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	406	344	84.7

       • Backbone atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	129	128	99.2

       • Side chain atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	277	216	78.0

       • Methyl group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	25	21	84.0

       • Aromatic group atoms

         Atom group	# of target shifts	# of assigned shifts	Completeness (%)
         1H chemical shifts	17	11	64.7

   • Histogram of normalized assigned chemical shifts
   • Random coil index and derived parameters (S² and NMR RMSD)
     • Chain_ID: 1