Solution sturcture of human MEKK3 PB1 domain cis isomer
MQSDVRIKFE HNGERRIIAF SRPVKYEDVE HKVTTVFGQP LDLHYMNNEL SILLKNQDDL DKAIDILDRS SSMKSLRILL LSQDRNLEHH HHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.5 % (953 of 1142) | 85.3 % (511 of 599) | 79.2 % (350 of 442) | 91.1 % (92 of 101) |
Backbone | 88.4 % (495 of 560) | 88.3 % (166 of 188) | 87.9 % (246 of 280) | 90.2 % (83 of 92) |
Sidechain | 80.1 % (540 of 674) | 83.9 % (345 of 411) | 73.2 % (186 of 254) | 100.0 % (9 of 9) |
Aromatic | 25.6 % (21 of 82) | 51.2 % (21 of 41) | 0.0 % (0 of 41) | |
Methyl | 93.3 % (97 of 104) | 92.3 % (48 of 52) | 94.2 % (49 of 52) |
1. MEKK3 PB1-cis
MQSDVRIKFE HNGERRIIAF SRPVKYEDVE HKVTTVFGQP LDLHYMNNEL SILLKNQDDL DKAIDILDRS SSMKSLRILL LSQDRNLEHH HHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5mM 15N,13C-labeled MEKK3 PB1 50mM phosphate buffer (pH 6.0), 1mM EDTA,10%(v/v) D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MEKK3 PB1-cis | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | phosphate buffer | 50 mM | ||
3 | EDTA | 1 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5mM 15N,13C-labeled MEKK3 PB1 50mM phosphate buffer (pH 6.0), 1mM EDTA,10%(v/v) D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | MEKK3 PB1-cis | [U-100% 15N] | 0.8 mM | |
7 | phosphate buffer | 50 mM | ||
8 | EDTA | 1 mM | ||
9 | H2O | 90 % | ||
10 | D2O | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.25144 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.10133 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.25144 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.10133 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.25144 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.10133 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.25144 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.10133 |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5mM 15N,13C-labeled MEKK3 PB1 50mM phosphate buffer (pH 6.0), 1mM EDTA,10%(v/v) D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MEKK3 PB1-cis | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | phosphate buffer | 50 mM | ||
3 | EDTA | 1 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5mM 15N,13C-labeled MEKK3 PB1 50mM phosphate buffer (pH 6.0), 1mM EDTA,10%(v/v) D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MEKK3 PB1-cis | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | phosphate buffer | 50 mM | ||
3 | EDTA | 1 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5mM 15N,13C-labeled MEKK3 PB1 50mM phosphate buffer (pH 6.0), 1mM EDTA,10%(v/v) D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MEKK3 PB1-cis | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | phosphate buffer | 50 mM | ||
3 | EDTA | 1 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5mM 15N,13C-labeled MEKK3 PB1 50mM phosphate buffer (pH 6.0), 1mM EDTA,10%(v/v) D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MEKK3 PB1-cis | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | phosphate buffer | 50 mM | ||
3 | EDTA | 1 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5mM 15N,13C-labeled MEKK3 PB1 50mM phosphate buffer (pH 6.0), 1mM EDTA,10%(v/v) D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MEKK3 PB1-cis | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | phosphate buffer | 50 mM | ||
3 | EDTA | 1 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5mM 15N,13C-labeled MEKK3 PB1 50mM phosphate buffer (pH 6.0), 1mM EDTA,10%(v/v) D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MEKK3 PB1-cis | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | phosphate buffer | 50 mM | ||
3 | EDTA | 1 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5mM 15N,13C-labeled MEKK3 PB1 50mM phosphate buffer (pH 6.0), 1mM EDTA,10%(v/v) D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MEKK3 PB1-cis | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | phosphate buffer | 50 mM | ||
3 | EDTA | 1 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5mM 15N,13C-labeled MEKK3 PB1 50mM phosphate buffer (pH 6.0), 1mM EDTA,10%(v/v) D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MEKK3 PB1-cis | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | phosphate buffer | 50 mM | ||
3 | EDTA | 1 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5mM 15N,13C-labeled MEKK3 PB1 50mM phosphate buffer (pH 6.0), 1mM EDTA,10%(v/v) D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MEKK3 PB1-cis | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | phosphate buffer | 50 mM | ||
3 | EDTA | 1 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5mM 15N,13C-labeled MEKK3 PB1 50mM phosphate buffer (pH 6.0), 1mM EDTA,10%(v/v) D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MEKK3 PB1-cis | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | phosphate buffer | 50 mM | ||
3 | EDTA | 1 mM | ||
4 | H2O | 90 % | ||
5 | D2O | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15332_2jrh.nef |
Input source #2: Coordindates | 2jrh.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
0--------10--------20--------30--------40--------50--------60--------70--------80--------90--- MQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80--------90----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 94 | 0 | 0 | 100.0 |
Content subtype: combined_15332_2jrh.nef
Assigned chemical shifts
0--------10--------20--------30--------40--------50--------60--------70--------80--------90--- MQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRN 0--------10--------20--------30--------40--------50--------60--------70--------80-----
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
2 | SER | HG | 4.778 |
10 | HIS | HD1 | 9.046 |
71 | SER | HG | 4.778 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 599 | 518 | 86.5 |
13C chemical shifts | 442 | 348 | 78.7 |
15N chemical shifts | 108 | 93 | 86.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 188 | 169 | 89.9 |
13C chemical shifts | 188 | 163 | 86.7 |
15N chemical shifts | 92 | 82 | 89.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 411 | 349 | 84.9 |
13C chemical shifts | 254 | 185 | 72.8 |
15N chemical shifts | 16 | 11 | 68.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 55 | 49 | 89.1 |
13C chemical shifts | 55 | 48 | 87.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 21 | 51.2 |
13C chemical shifts | 41 | 0 | 0.0 |
Distance restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90--- MQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRN 0--------10--------20--------30--------40--------50--------60--------70--------80-----
Dihedral angle restraints
0--------10--------20--------30--------40--------50--------60--------70--------80--------90--- MQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH ||||||||||||||||| |||||||||||| |||||||||| |||||| ||||||||||||||||| |||||||||| ....VRIKFEHNGERRIIAFS...KYEDVEHKVTTV.GQPLDLHYMN.ELSILL.NQDDLDKAIDILDRSSS..SLRILLLSQD 0--------10--------20--------30--------40--------50--------60--------70--------80---