Solution NMR Structure of Human Myeloid Differentiation Primary Response (MyD88). Northeast Structural Genomics target HR2869A.
MGITTLDDPL GHMPERFDAF ICYCPSDIQF VQEMIRQLEQ TNYRLKLCVS DRDVLPGTCV WSIASELIEK RCRRMVVVVS DDYLQSKECD FQTKFALSLS PGAHQKRLIP IKYKAMKKEF PSILRFITVC DYTNPCTKSW FWTRLAKALS LPLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.4 % (1818 of 1947) | 94.6 % (961 of 1016) | 92.3 % (709 of 768) | 90.8 % (148 of 163) |
Backbone | 92.1 % (868 of 942) | 93.7 % (295 of 315) | 91.8 % (437 of 476) | 90.1 % (136 of 151) |
Sidechain | 94.6 % (1098 of 1161) | 95.0 % (666 of 701) | 93.8 % (420 of 448) | 100.0 % (12 of 12) |
Aromatic | 80.9 % (152 of 188) | 80.9 % (76 of 94) | 80.2 % (73 of 91) | 100.0 % (3 of 3) |
Methyl | 100.0 % (172 of 172) | 100.0 % (86 of 86) | 100.0 % (86 of 86) |
1. HR2869A
MGITTLDDPL GHMPERFDAF ICYCPSDIQF VQEMIRQLEQ TNYRLKLCVS DRDVLPGTCV WSIASELIEK RCRRMVVVVS DDYLQSKECD FQTKFALSLS PGAHQKRLIP IKYKAMKKEF PSILRFITVC DYTNPCTKSW FWTRLAKALS LPLEHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0, Details Sample 1 liophylized and resuspended pH matched to starting sample by deuterated Acetic Acid
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
6 | DTT | natural abundance | 10 mM | |
7 | ammonium acetate | natural abundance | 40 mM | |
8 | acetonitrile | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | ammonium acetate | natural abundance | 40 mM | |
12 | acetonitrile | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-5% 13C; U-100% 15N] | 0.8 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | ammonium acetate | natural abundance | 40 mM | |
4 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | ammonium acetate | natural abundance | 40 mM | |
12 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0, Details Sample 1 liophylized and resuspended pH matched to starting sample by deuterated Acetic Acid
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
6 | DTT | natural abundance | 10 mM | |
7 | ammonium acetate | natural abundance | 40 mM | |
8 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0, Details Sample 1 liophylized and resuspended pH matched to starting sample by deuterated Acetic Acid
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
6 | DTT | natural abundance | 10 mM | |
7 | ammonium acetate | natural abundance | 40 mM | |
8 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0, Details Sample 1 liophylized and resuspended pH matched to starting sample by deuterated Acetic Acid
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
6 | DTT | natural abundance | 10 mM | |
7 | ammonium acetate | natural abundance | 40 mM | |
8 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | ammonium acetate | natural abundance | 40 mM | |
12 | acetonitrile | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 303 K, pH 5.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | entity | [U-100% 13C; U-100% 15N] | 0.8 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | ammonium acetate | natural abundance | 40 mM | |
12 | acetonitrile | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_15356_2js7.nef |
Input source #2: Coordindates | 2js7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:48:CYS:SG | A:72:CYS:SG | reduced, CA 54.722, CB 32.37 ppm | reduced, CA 57.335, CB 28.95 ppm | 2.903 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLS -------110-------120-------130-------140-------150-------160 PGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLPLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLPLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 160 | 0 | 0 | 100.0 |
Content subtype: combined_15356_2js7.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLS ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160 PGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLPLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||| PGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLPLEH -------110-------120-------130-------140-------150-----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1016 | 960 | 94.5 |
13C chemical shifts | 768 | 708 | 92.2 |
15N chemical shifts | 173 | 155 | 89.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 315 | 294 | 93.3 |
13C chemical shifts | 320 | 288 | 90.0 |
15N chemical shifts | 151 | 133 | 88.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 701 | 666 | 95.0 |
13C chemical shifts | 448 | 420 | 93.8 |
15N chemical shifts | 22 | 22 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 91 | 90 | 98.9 |
13C chemical shifts | 91 | 90 | 98.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 94 | 76 | 80.9 |
13C chemical shifts | 91 | 73 | 80.2 |
15N chemical shifts | 3 | 3 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLS |||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| ..ITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVS.RDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160 PGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLPLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||| PGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLPLE -------110-------120-------130-------140-------150----