Simian Foamy Virus (mac) protease structure
MDPLQLLQPL EAEIKGTKLK AHWDSGATIT CVPEAFLEDE RPIQTMLIKT IHGEKQQDVY YLTFKVQGRK VEAEVLASPY DYILLNPSDV PWLMKKPLQL THHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.3 % (1127 of 1306) | 85.3 % (581 of 681) | 87.2 % (450 of 516) | 88.1 % (96 of 109) |
Backbone | 89.5 % (560 of 626) | 89.0 % (187 of 210) | 89.3 % (283 of 317) | 90.9 % (90 of 99) |
Sidechain | 84.4 % (661 of 783) | 83.7 % (394 of 471) | 86.4 % (261 of 302) | 60.0 % (6 of 10) |
Aromatic | 75.9 % (82 of 108) | 77.8 % (42 of 54) | 73.1 % (38 of 52) | 100.0 % (2 of 2) |
Methyl | 93.8 % (122 of 130) | 95.4 % (62 of 65) | 92.3 % (60 of 65) |
1. SFVmac Pol 1-101 6His
MDPLQLLQPL EAEIKGTKLK AHWDSGATIT CVPEAFLEDE RPIQTMLIKT IHGEKQQDVY YLTFKVQGRK VEAEVLASPY DYILLNPSDV PWLMKKPLQL THHHHHHPressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SFVmac Pol 1-101 6His | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | phosphate buffer 7.4 | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | DTT | 0.0 ~ 0.0 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | indirect | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl carbons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | liquid anhydrous ammonia | nitrogen | 0.0 ppm | na | indirect | 1.0 |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SFVmac Pol 1-101 6His | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | phosphate buffer 7.4 | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | DTT | 0.0 ~ 0.0 mM |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SFVmac Pol 1-101 6His | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | phosphate buffer 7.4 | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | DTT | 0.0 ~ 0.0 mM |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SFVmac Pol 1-101 6His | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | phosphate buffer 7.4 | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | DTT | 0.0 ~ 0.0 mM |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SFVmac Pol 1-101 6His | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | phosphate buffer 7.4 | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | DTT | 0.0 ~ 0.0 mM |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SFVmac Pol 1-101 6His | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | phosphate buffer 7.4 | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | DTT | 0.0 ~ 0.0 mM |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SFVmac Pol 1-101 6His | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | phosphate buffer 7.4 | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | DTT | 0.0 ~ 0.0 mM |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SFVmac Pol 1-101 6His | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | phosphate buffer 7.4 | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | DTT | 0.0 ~ 0.0 mM |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SFVmac Pol 1-101 6His | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | phosphate buffer 7.4 | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | DTT | 0.0 ~ 0.0 mM |
Bruker Avance - 700 MHz equipped with CryoProbe
State isotropic, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SFVmac Pol 1-101 6His | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | phosphate buffer 7.4 | 50 mM | ||
3 | NaCl | 100 mM | ||
4 | DTT | 0.0 ~ 0.0 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr15403_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDPLQLLQPLEAEIKGTKLKAHWDSGATITCVPEAFLEDERPIQTMLIKTIHGEKQQDVYYLTFKVQGRKVEAEVLASPYDYILLNPSDVPWLMKKPLQL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..PLQLLQPLEAEIKGTKLKAHWDSGATITCVPEAFLEDERPIQTMLIKTIHGEKQQDVYYLTFKVQGRKVEAEVLASPYDYILLNPSDVPWLMKKPLQL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ------- THHHHHH
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 681 | 578 | 84.9 |
13C chemical shifts | 516 | 442 | 85.7 |
15N chemical shifts | 111 | 94 | 84.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 210 | 186 | 88.6 |
13C chemical shifts | 214 | 185 | 86.4 |
15N chemical shifts | 99 | 88 | 88.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 471 | 392 | 83.2 |
13C chemical shifts | 302 | 257 | 85.1 |
15N chemical shifts | 12 | 6 | 50.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 60 | 88.2 |
13C chemical shifts | 68 | 58 | 85.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 40 | 74.1 |
13C chemical shifts | 52 | 37 | 71.2 |
15N chemical shifts | 2 | 2 | 100.0 |