Solution structure of Sso6901 from Sulfolobus solfataricus P2
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.2 % (708 of 736) | 96.2 % (378 of 393) | 96.5 % (279 of 289) | 94.4 % (51 of 54) |
Backbone | 96.0 % (332 of 346) | 95.8 % (114 of 119) | 96.6 % (168 of 174) | 94.3 % (50 of 53) |
Sidechain | 96.4 % (428 of 444) | 96.4 % (264 of 274) | 96.4 % (163 of 169) | 100.0 % (1 of 1) |
Aromatic | 96.2 % (50 of 52) | 96.2 % (25 of 26) | 96.0 % (24 of 25) | 100.0 % (1 of 1) |
Methyl | 98.2 % (55 of 56) | 100.0 % (28 of 28) | 96.4 % (27 of 28) |
1. Cren7
MSSGKKPVKV KTPAGKEAEL VPEKVWALAP KGRKGVKIGL FKDPETGKYF RHKLPDDYPISolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.0 ~ 2.0 mM | |
2 | DSS | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1.0 ~ 2.0 mM | |
5 | DSS | natural abundance | 0.01 % | |
6 | potassium phosphate | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.0 ~ 2.0 mM | |
2 | DSS | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.0 ~ 2.0 mM | |
2 | DSS | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1.0 ~ 2.0 mM | |
2 | DSS | natural abundance | 0.01 % | |
3 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1.0 ~ 2.0 mM | |
5 | DSS | natural abundance | 0.01 % | |
6 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1.0 ~ 2.0 mM | |
5 | DSS | natural abundance | 0.01 % | |
6 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1.0 ~ 2.0 mM | |
5 | DSS | natural abundance | 0.01 % | |
6 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1.0 ~ 2.0 mM | |
5 | DSS | natural abundance | 0.01 % | |
6 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1.0 ~ 2.0 mM | |
5 | DSS | natural abundance | 0.01 % | |
6 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1.0 ~ 2.0 mM | |
5 | DSS | natural abundance | 0.01 % | |
6 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1.0 ~ 2.0 mM | |
5 | DSS | natural abundance | 0.01 % | |
6 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1.0 ~ 2.0 mM | |
5 | DSS | natural abundance | 0.01 % | |
6 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1.0 ~ 2.0 mM | |
5 | DSS | natural abundance | 0.01 % | |
6 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1.0 ~ 2.0 mM | |
5 | DSS | natural abundance | 0.01 % | |
6 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1.0 ~ 2.0 mM | |
5 | DSS | natural abundance | 0.01 % | |
6 | potassium phosphate | natural abundance | 50 mM |
Bruker DMX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity | [U-13C; U-15N] | 1.0 ~ 2.0 mM | |
5 | DSS | natural abundance | 0.01 % | |
6 | potassium phosphate | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15415_2jtm.nef |
Input source #2: Coordindates | 2jtm.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60 MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 60 | 0 | 0 | 100.0 |
Content subtype: combined_15415_2jtm.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60 MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..SGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 393 | 378 | 96.2 |
13C chemical shifts | 289 | 279 | 96.5 |
15N chemical shifts | 56 | 51 | 91.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 119 | 114 | 95.8 |
13C chemical shifts | 120 | 116 | 96.7 |
15N chemical shifts | 53 | 50 | 94.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 274 | 264 | 96.4 |
13C chemical shifts | 169 | 163 | 96.4 |
15N chemical shifts | 3 | 1 | 33.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 29 | 28 | 96.6 |
13C chemical shifts | 29 | 27 | 93.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 26 | 25 | 96.2 |
13C chemical shifts | 25 | 24 | 96.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60 MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...GKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60 MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |||||||||||||||||||||||||| |||||||||||||||||||||||| ....KKPVKVKTPAGKEAELVPEKVWALAP....GVKIGLFKDPETGKYFRHKLPDDY --------10--------20--------30--------40--------50--------