TolR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.1 % (807 of 849) | 95.2 % (418 of 439) | 94.0 % (312 of 332) | 98.7 % (77 of 78) |
Backbone | 97.3 % (428 of 440) | 96.8 % (150 of 155) | 97.2 % (207 of 213) | 98.6 % (71 of 72) |
Sidechain | 93.7 % (444 of 474) | 94.4 % (268 of 284) | 92.4 % (170 of 184) | 100.0 % (6 of 6) |
Aromatic | 65.0 % (26 of 40) | 90.0 % (18 of 20) | 40.0 % (8 of 20) | |
Methyl | 92.3 % (96 of 104) | 88.5 % (46 of 52) | 96.2 % (50 of 52) |
1. TolR
GSVPVILEVA GIGKYAISIG GERQEGLTEE MVTQLSRQEF DKDNNTLFLV GGAKEVPYEE VIKALNLLHL AGIKPressure 1 atm, Temperature 303 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TolR | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50.0 ~ 100.0 mM | |
4 | EDTA | natural abundance | 0.05 mM | |
5 | D2O | natural abundance | 5.0 ~ 10.0 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | carbons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.725 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | carbons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.725 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | carbons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.725 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | carbons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.725 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker DRX - 600 MHz
State isotropic, Pressure 1 atm, Temperature 303 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TolR | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50.0 ~ 100.0 mM | |
4 | EDTA | natural abundance | 0.05 mM | |
5 | D2O | natural abundance | 5.0 ~ 10.0 % |
Bruker DRX - 600 MHz
State isotropic, Pressure 1 atm, Temperature 303 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TolR | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50.0 ~ 100.0 mM | |
4 | EDTA | natural abundance | 0.05 mM | |
5 | D2O | natural abundance | 5.0 ~ 10.0 % |
Bruker DRX - 600 MHz
State isotropic, Pressure 1 atm, Temperature 303 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TolR | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50.0 ~ 100.0 mM | |
4 | EDTA | natural abundance | 0.05 mM | |
5 | D2O | natural abundance | 5.0 ~ 10.0 % |
Bruker DRX - 600 MHz
State isotropic, Pressure 1 atm, Temperature 303 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TolR | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50.0 ~ 100.0 mM | |
4 | EDTA | natural abundance | 0.05 mM | |
5 | D2O | natural abundance | 5.0 ~ 10.0 % |
Bruker DRX - 600 MHz
State isotropic, Pressure 1 atm, Temperature 303 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TolR | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50.0 ~ 100.0 mM | |
4 | EDTA | natural abundance | 0.05 mM | |
5 | D2O | natural abundance | 5.0 ~ 10.0 % |
Bruker DRX - 600 MHz
State isotropic, Pressure 1 atm, Temperature 303 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TolR | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50.0 ~ 100.0 mM | |
4 | EDTA | natural abundance | 0.05 mM | |
5 | D2O | natural abundance | 5.0 ~ 10.0 % |
Bruker DRX - 600 MHz
State isotropic, Pressure 1 atm, Temperature 303 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TolR | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50.0 ~ 100.0 mM | |
4 | EDTA | natural abundance | 0.05 mM | |
5 | D2O | natural abundance | 5.0 ~ 10.0 % |
Bruker DRX - 600 MHz
State isotropic, Pressure 1 atm, Temperature 303 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TolR | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50.0 ~ 100.0 mM | |
4 | EDTA | natural abundance | 0.05 mM | |
5 | D2O | natural abundance | 5.0 ~ 10.0 % |
Bruker DRX - 600 MHz
State isotropic, Pressure 1 atm, Temperature 303 K, pH 6.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TolR | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50.0 ~ 100.0 mM | |
4 | EDTA | natural abundance | 0.05 mM | |
5 | D2O | natural abundance | 5.0 ~ 10.0 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr15459_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70---- GSVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKALNLLHLAGIK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKALNLLHLAGIK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 439 | 428 | 97.5 |
13C chemical shifts | 332 | 312 | 94.0 |
15N chemical shifts | 80 | 77 | 96.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 155 | 153 | 98.7 |
13C chemical shifts | 148 | 143 | 96.6 |
15N chemical shifts | 72 | 70 | 97.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 284 | 275 | 96.8 |
13C chemical shifts | 184 | 169 | 91.8 |
15N chemical shifts | 8 | 7 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 49 | 92.5 |
13C chemical shifts | 53 | 51 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 20 | 18 | 90.0 |
13C chemical shifts | 20 | 8 | 40.0 |