Backbone and side-chain 1H, 13C and 15N resonance assignments for the E2 conjugating enzyme, UbcH7
AASRRLMKEL EEIRKSGMKN FRNIQVDEAN LLTWQGLIVP DNPPYDKGAF RIEINFPAEY PFKPPKITFK TKIYHPNIDE KGQVCLPVIS AENWKPATKT DQVIQSLIAL VNDPQPEHPL RADLAEEYSK DRKKFSKNAE EFTKKYGEKR PVD
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 73.5 % (1387 of 1887) | 62.7 % (629 of 1003) | 83.4 % (607 of 728) | 96.8 % (151 of 156) |
Backbone | 92.0 % (819 of 890) | 83.5 % (248 of 297) | 95.6 % (434 of 454) | 98.6 % (137 of 139) |
Sidechain | 62.4 % (714 of 1145) | 54.0 % (381 of 706) | 75.6 % (319 of 422) | 82.4 % (14 of 17) |
Aromatic | 16.9 % (24 of 142) | 18.3 % (13 of 71) | 15.9 % (11 of 69) | 0.0 % (0 of 2) |
Methyl | 96.6 % (141 of 146) | 97.3 % (71 of 73) | 95.9 % (70 of 73) |
1. UbcH7
AASRRLMKEL EEIRKSGMKN FRNIQVDEAN LLTWQGLIVP DNPPYDKGAF RIEINFPAEY PFKPPKITFK TKIYHPNIDE KGQVCLPVIS AENWKPATKT DQVIQSLIAL VNDPQPEHPL RADLAEEYSK DRKKFSKNAE EFTKKYGEKR PVDSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UbcH7 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UbcH7 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UbcH7 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UbcH7 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UbcH7 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UbcH7 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UbcH7 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UbcH7 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 (±0.1) K, pH 7.0 (±0.01)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | UbcH7 | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | natural abundance | 25 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | DTT | natural abundance | 5 mM | |
5 | sodium chloride | natural abundance | 200 mM |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr15498_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 AASRRLMKELEEIRKSGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKT ||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||| |||||||||||||||||||||||||||||||||||| .ASRRLMKELEEIRKSGMKNFRNIQVDEANLLTWQGLIVPDN.PYDKGAFRIEINFPAEYPFK.PKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKT -------110-------120-------130-------140-------150--- DQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFSKNAEEFTKKYGEKRPVD ||||||||||||||||||||||||||||||||||||||||||||||||||||| DQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFSKNAEEFTKKYGEKRPVD
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
20 | ASN | CG | 177.042 |
23 | ASN | CG | 177.894 |
25 | GLN | CD | 180.566 |
35 | GLN | CD | 180.157 |
55 | ASN | CG | 176.503 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1003 | 594 | 59.2 |
13C chemical shifts | 728 | 597 | 82.0 |
15N chemical shifts | 164 | 150 | 91.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 297 | 246 | 82.8 |
13C chemical shifts | 306 | 285 | 93.1 |
15N chemical shifts | 139 | 136 | 97.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 706 | 348 | 49.3 |
13C chemical shifts | 422 | 312 | 73.9 |
15N chemical shifts | 25 | 14 | 56.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 75 | 71 | 94.7 |
13C chemical shifts | 75 | 69 | 92.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 71 | 9 | 12.7 |
13C chemical shifts | 69 | 9 | 13.0 |
15N chemical shifts | 2 | 0 | 0.0 |