Solution Structure of Human C6orf115 Protein
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.9 % (942 of 1048) | 90.8 % (491 of 541) | 87.9 % (363 of 413) | 93.6 % (88 of 94) |
Backbone | 92.5 % (492 of 532) | 94.0 % (172 of 183) | 91.6 % (239 of 261) | 92.0 % (81 of 88) |
Sidechain | 87.6 % (525 of 599) | 88.8 % (318 of 358) | 85.5 % (201 of 235) | 100.0 % (6 of 6) |
Aromatic | 31.1 % (23 of 74) | 35.1 % (13 of 37) | 27.0 % (10 of 37) | |
Methyl | 98.4 % (120 of 122) | 98.4 % (60 of 61) | 98.4 % (60 of 61) |
1. c6orf115
MNVDHEVNLL VEEIHRLGSK NADGKLSVKF GVLFRDDKSA NLFEALVGTL KAAKRRKIVT YPGELLLQGV HDDVDIILLQ DLEHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | potassium chloride | natural abundance | 20 mM | |
3 | sodium acetate/acetic acid | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.05 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 15N] | 1.5 mM | |
6 | potassium chloride | natural abundance | 20 mM | |
7 | sodium acetate/acetic acid | natural abundance | 50 mM | |
8 | sodium azide | natural abundance | 0.05 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker DMX - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 15N] | 1.5 mM | |
6 | potassium chloride | natural abundance | 20 mM | |
7 | sodium acetate/acetic acid | natural abundance | 50 mM | |
8 | sodium azide | natural abundance | 0.05 % |
Bruker DMX - 600 MHz cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | potassium chloride | natural abundance | 20 mM | |
3 | sodium acetate/acetic acid | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.05 % |
Bruker DMX - 600 MHz cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | potassium chloride | natural abundance | 20 mM | |
3 | sodium acetate/acetic acid | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.05 % |
Bruker DMX - 600 MHz cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | potassium chloride | natural abundance | 20 mM | |
3 | sodium acetate/acetic acid | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.05 % |
Bruker DMX - 600 MHz cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | potassium chloride | natural abundance | 20 mM | |
3 | sodium acetate/acetic acid | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.05 % |
Bruker DMX - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 15N] | 1.5 mM | |
6 | potassium chloride | natural abundance | 20 mM | |
7 | sodium acetate/acetic acid | natural abundance | 50 mM | |
8 | sodium azide | natural abundance | 0.05 % |
Bruker DMX - 600 MHz cryo-probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | entity | [U-100% 15N] | 1.5 mM | |
6 | potassium chloride | natural abundance | 20 mM | |
7 | sodium acetate/acetic acid | natural abundance | 50 mM | |
8 | sodium azide | natural abundance | 0.05 % |
Bruker DMX - 600 MHz cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | potassium chloride | natural abundance | 20 mM | |
3 | sodium acetate/acetic acid | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.05 % |
Bruker DMX - 600 MHz cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | potassium chloride | natural abundance | 20 mM | |
3 | sodium acetate/acetic acid | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.05 % |
Bruker DMX - 600 MHz cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | potassium chloride | natural abundance | 20 mM | |
3 | sodium acetate/acetic acid | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.05 % |
Bruker DMX - 600 MHz cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | potassium chloride | natural abundance | 20 mM | |
3 | sodium acetate/acetic acid | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.05 % |
Bruker DMX - 600 MHz cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | potassium chloride | natural abundance | 20 mM | |
3 | sodium acetate/acetic acid | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.05 % |
Bruker DMX - 600 MHz cryo-probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 310 K, pH 4.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | potassium chloride | natural abundance | 20 mM | |
3 | sodium acetate/acetic acid | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.05 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr15549_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------- MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKSANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQDLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKSANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQDLEHH --------10--------20--------30--------40--------50--------60--------70--------80-----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 541 | 489 | 90.4 |
13C chemical shifts | 413 | 363 | 87.9 |
15N chemical shifts | 98 | 90 | 91.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 183 | 171 | 93.4 |
13C chemical shifts | 178 | 161 | 90.4 |
15N chemical shifts | 88 | 80 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 358 | 318 | 88.8 |
13C chemical shifts | 235 | 202 | 86.0 |
15N chemical shifts | 10 | 10 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 61 | 98.4 |
13C chemical shifts | 62 | 61 | 98.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 37 | 12 | 32.4 |
13C chemical shifts | 37 | 10 | 27.0 |