Solution Structure of the inner DysF domain of human myoferlin
IDPFTADAGH TEFTDEVYQN ESRYPGGDWK PAEDTYTDAN GDKAASPSEL TCPPGWEWED DAWSYDINRA VDEKGWEYGI TIPPDHKPKS WVAAEKMYHT HRRRRLVRKR KKDLTQTASS TAR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.7 % (1396 of 1415) | 98.2 % (726 of 739) | 99.1 % (546 of 551) | 99.2 % (124 of 125) |
Backbone | 98.9 % (712 of 720) | 98.0 % (239 of 244) | 99.4 % (360 of 362) | 99.1 % (113 of 114) |
Sidechain | 98.6 % (800 of 811) | 98.4 % (487 of 495) | 99.0 % (302 of 305) | 100.0 % (11 of 11) |
Aromatic | 97.4 % (152 of 156) | 97.4 % (76 of 78) | 97.2 % (70 of 72) | 100.0 % (6 of 6) |
Methyl | 100.0 % (90 of 90) | 100.0 % (45 of 45) | 100.0 % (45 of 45) |
1. DysF
IDPFTADAGH TEFTDEVYQN ESRYPGGDWK PAEDTYTDAN GDKAASPSEL TCPPGWEWED DAWSYDINRA VDEKGWEYGI TIPPDHKPKS WVAAEKMYHT HRRRRLVRKR KKDLTQTASS TARSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N-labelled DysF domain in 20mM MES, 100mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DysF | [U-100% 15N] | 1.3 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C-labelled DysF domain in 20 mM MES, 100 mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | D2O | 10 % | ||
10 | H2O | natural abundance | 90 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C DysF in 20 mM MES, 100 mM NaCl, pH 6.5, in ~100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
12 | MES | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | D2O | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N-labelled DysF domain in 20mM MES, 100mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DysF | [U-100% 15N] | 1.3 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C-labelled DysF domain in 20 mM MES, 100 mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | D2O | 10 % | ||
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C DysF in 20 mM MES, 100 mM NaCl, pH 6.5, in ~100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
12 | MES | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | D2O | 100 % |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N-labelled DysF domain in 20mM MES, 100mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DysF | [U-100% 15N] | 1.3 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N-labelled DysF domain in 20mM MES, 100mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DysF | [U-100% 15N] | 1.3 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C-labelled DysF domain in 20 mM MES, 100 mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | D2O | 10 % | ||
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C-labelled DysF domain in 20 mM MES, 100 mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | D2O | 10 % | ||
10 | H2O | natural abundance | 90 % |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C-labelled DysF domain in 20 mM MES, 100 mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | D2O | 10 % | ||
10 | H2O | natural abundance | 90 % |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C-labelled DysF domain in 20 mM MES, 100 mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | D2O | 10 % | ||
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C-labelled DysF domain in 20 mM MES, 100 mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | D2O | 10 % | ||
10 | H2O | natural abundance | 90 % |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C-labelled DysF domain in 20 mM MES, 100 mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | D2O | 10 % | ||
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C-labelled DysF domain in 20 mM MES, 100 mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | D2O | 10 % | ||
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C-labelled DysF domain in 20 mM MES, 100 mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
7 | MES | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | D2O | 10 % | ||
10 | H2O | natural abundance | 90 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C DysF in 20 mM MES, 100 mM NaCl, pH 6.5, in ~100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
12 | MES | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | D2O | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C DysF in 20 mM MES, 100 mM NaCl, pH 6.5, in ~100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
12 | MES | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | D2O | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C DysF in 20 mM MES, 100 mM NaCl, pH 6.5, in ~100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
12 | MES | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | D2O | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C DysF in 20 mM MES, 100 mM NaCl, pH 6.5, in ~100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
12 | MES | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | D2O | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C DysF in 20 mM MES, 100 mM NaCl, pH 6.5, in ~100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
12 | MES | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | D2O | 100 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N/13C DysF in 20 mM MES, 100 mM NaCl, pH 6.5, in ~100% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | DysF | [U-100% 13C; U-100% 15N] | 1.3 mM | |
12 | MES | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | D2O | 100 % |
Varian UnityPlus - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N-labelled DysF domain in 20mM MES, 100mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DysF | [U-100% 15N] | 1.3 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Varian UnityPlus - 500 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 15N-labelled DysF domain in 20mM MES, 100mM NaCl, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DysF | [U-100% 15N] | 1.3 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | 10 % | ||
5 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_15718_2k2o.nef |
Input source #2: Coordindates | 2k2o.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--920-----930-------940-------950-------960-------970-------980-------990------1000------1010------1 IDPFTADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| IDPFTADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 020------1030------1040 HRRRRLVRKRKKDLTQTASSTAR ||||||||||||||||||||||| HRRRRLVRKRKKDLTQTASSTAR -------110-------120---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 123 | 0 | 0 | 100.0 |
Content subtype: combined_15718_2k2o.nef
Assigned chemical shifts
--920-----930-------940-------950-------960-------970-------980-------990------1000------1010------1 IDPFTADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| IDPFTADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHT 020------1030------1040 HRRRRLVRKRKKDLTQTASSTAR ||||||||||||||||||||||| HRRRRLVRKRKKDLTQTASSTAR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 739 | 729 | 98.6 |
13C chemical shifts | 551 | 544 | 98.7 |
15N chemical shifts | 134 | 132 | 98.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 244 | 243 | 99.6 |
13C chemical shifts | 246 | 244 | 99.2 |
15N chemical shifts | 114 | 113 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 495 | 486 | 98.2 |
13C chemical shifts | 305 | 300 | 98.4 |
15N chemical shifts | 20 | 19 | 95.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 46 | 100.0 |
13C chemical shifts | 46 | 46 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 76 | 97.4 |
13C chemical shifts | 72 | 70 | 97.2 |
15N chemical shifts | 6 | 6 | 100.0 |
Distance restraints
--920-----930-------940-------950-------960-------970-------980-------990------1000------1010------1 IDPFTADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHT | ||| | | |||||||||||||||||||| |||| | |||| |||||| ||||||||| | ||||| ||||||| |||||| ||||||| ||||| I.PFT.D..H.EFTDEVYQNESRYPGGDWKP.EDTY.D.NGDK..SPSELT.PPGWEWEDD.W.YDINR.VDEKGWE.GITIPP.HKPKSWV..EKMYH. --920-----930-------940-------950-------960-------970-------980-------990------1000------1010------1 020------1030------1040 HRRRRLVRKRKKDLTQTASSTAR |||||||||||||| || | HRRRRLVRKRKKDL.QT...T 020------1030--------
--920-----930-------940-------950-------960-------970-------980-------990------1000------1010------1 IDPFTADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHT ||||||||||||||| || |||| ||||| || || |||| |||||| |||||| || |||||||| || |||| |||| ........GHTEFTDEVYQNESR.PG..WKPA.DTYTD....KA.SP..LTCP.GWEWED.AWSYDI...VD..GWEYGITI....KP..WVAA..MYHT --920-----930-------940-------950-------960-------970-------980-------990------1000------1010------1 020------1030------1040 HRRRRLVRKRKKDLTQTASSTAR |||||||||||||| | HRRRRLVRKRKKDL.Q 020------1030---
--920-----930-------940-------950-------960-------970-------980-------990------1000------1010------1 IDPFTADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| IDPFTADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHT 020------1030------1040 HRRRRLVRKRKKDLTQTASSTAR |||||||||||||||||| || HRRRRLVRKRKKDLTQTA...AR
--920-----930-------940-------950-------960-------970-------980-------990------1000------1010------1 IDPFTADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHT || | | ||| || |||||||||||| |||||| ||| ||| | | | | |||||| | | |||||| |||||| ......DA.H.E..........RYP.GD...AEDTYTDANGDK.ASPSEL.CPP.WEW.D.A....I.R.VDEKGW......P.D.KPKSWV.AEKMYH. --920-----930-------940-------950-------960-------970-------980-------990------1000------1010------1 020------1030------1040 HRRRRLVRKRKKDLTQTASSTAR | | |||||| H.......K.KKDLTQ 020------1030---
Dihedral angle restraints
--920-----930-------940-------950-------960-------970-------980-------990------1000------1010------1 IDPFTADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHT |||||||||||||| |||||||||||||||| ||||| |||| ||| ||||||| ||||||||||||||||| ||| | ..........TEFTDEVYQNESRY.....KPAEDTYTDANGDKAA.PSELT...GWEW.....SYD.NRAVDEK.WEYGITIPPDHKPKSWV...KMY.T --920-----930-------940-------950-------960-------970-------980-------990------1000------1010------1 020------1030------1040 HRRRRLVRKRKKDLTQTASSTAR |||||||||||| || HRRRRLVRKRKK.LT 020------1030--
RDC restraints
--920-----930-------940-------950-------960-------970-------980-------990------1000------1010------1 IDPFTADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHT ||||||||||||||| ||| | ||| ||||||| | | |||| |||||||||||||||| |||||| |||| || |||||||||||| .........HTEFTDEVYQNESRY.GGD.K.AED.YTDANGD.A.S.SELT...GWEWEDDAWSYDINRA.DEKGWE.GITI...HK.KSWVAAEKMYHT --920-----930-------940-------950-------960-------970-------980-------990------1000------1010------1 020------1030------1040 HRRRRLVRKRKKDLTQTASSTAR ||||| ||||||| HRRRR.VRKRKKD 020------1030