Solution Structure of IG-Like Domain 23 from Human Filamin A
GAMGDPGLVS AYGAGLEGGV TGNPAEFVVN TSNAGAGALS VTIDGPSKVK MDCQECPEGY RVTYTPMAPG SYLISIKYGG PYHIGGSPFK AKVTGPRLV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.4 % (974 of 1043) | 94.6 % (506 of 535) | 90.6 % (375 of 414) | 98.9 % (93 of 94) |
Backbone | 95.8 % (552 of 576) | 97.1 % (201 of 207) | 93.9 % (262 of 279) | 98.9 % (89 of 90) |
Sidechain | 91.8 % (503 of 548) | 93.3 % (306 of 328) | 89.4 % (193 of 216) | 100.0 % (4 of 4) |
Aromatic | 73.6 % (53 of 72) | 94.4 % (34 of 36) | 52.8 % (19 of 36) | |
Methyl | 98.0 % (100 of 102) | 98.0 % (50 of 51) | 98.0 % (50 of 51) |
1. FLNA23
GAMGDPGLVS AYGAGLEGGV TGNPAEFVVN TSNAGAGALS VTIDGPSKVK MDCQECPEGY RVTYTPMAPG SYLISIKYGG PYHIGGSPFK AKVTGPRLVSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.779117 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.779117 ppm | internal | direct | 1.0 |
15N | water | protons | 4.779117 ppm | internal | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.779117 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.779117 ppm | internal | direct | 1.0 |
15N | water | protons | 4.779117 ppm | internal | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.779117 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.779117 ppm | internal | direct | 1.0 |
15N | water | protons | 4.779117 ppm | internal | indirect | 0.101329 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.779117 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.779117 ppm | internal | direct | 1.0 |
15N | water | protons | 4.779117 ppm | internal | indirect | 0.101329 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Varian INOVA - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FLNA23 | [U-13C; U-15N] | 1 (±0.2) mM | |
2 | Sodium phosphate | natural abundance | 20 mM | |
3 | Sodium chloride | natural abundance | 150 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | Sodium azide | natural abundance | 2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_15777_2k3t.nef |
Input source #2: Coordindates | 2k3t.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---2430------2440------2450------2460------2470------2480------2490------2500------2510------2520-- GAMGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLV --------10--------20--------30--------40--------50--------60--------70--------80--------90---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 99 | 0 | 0 | 100.0 |
Content subtype: combined_15777_2k3t.nef
Assigned chemical shifts
---2430------2440------2450------2460------2470------2480------2490------2500------2510------2520-- GAMGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 535 | 519 | 97.0 |
13C chemical shifts | 414 | 374 | 90.3 |
15N chemical shifts | 96 | 92 | 95.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 207 | 205 | 99.0 |
13C chemical shifts | 198 | 180 | 90.9 |
15N chemical shifts | 90 | 88 | 97.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 328 | 314 | 95.7 |
13C chemical shifts | 216 | 194 | 89.8 |
15N chemical shifts | 6 | 4 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 54 | 100.0 |
13C chemical shifts | 54 | 53 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 34 | 94.4 |
13C chemical shifts | 36 | 19 | 52.8 |
Distance restraints
---2430------2440------2450------2460------2470------2480------2490------2500------2510------2520-- GAMGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...GDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLV