Solution structure of 30S ribosomal protein S27A from Thermoplasma acidophilum
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | na | sing | 1:CYS21:SG | 2:ZN1:ZN |
2 | na | sing | 1:CYS24:SG | 2:ZN1:ZN |
3 | na | sing | 1:CYS39:SG | 2:ZN1:ZN |
4 | na | sing | 1:CYS42:SG | 2:ZN1:ZN |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.7 % (582 of 664) | 86.5 % (307 of 355) | 87.5 % (223 of 255) | 96.3 % (52 of 54) |
Backbone | 95.4 % (311 of 326) | 93.8 % (106 of 113) | 95.6 % (153 of 160) | 98.1 % (52 of 53) |
Sidechain | 82.7 % (321 of 388) | 83.1 % (201 of 242) | 82.8 % (120 of 145) | 0.0 % (0 of 1) |
Aromatic | 62.9 % (39 of 62) | 80.6 % (25 of 31) | 45.2 % (14 of 31) | |
Methyl | 97.1 % (33 of 34) | 100.0 % (17 of 17) | 94.1 % (16 of 17) |
1. 30S ribosomal protein S27A
MQKRELYEIA DGKLVRKHRF CPRCGPGVFL AEHADRYSCG RCGYTEFKKA KKSKSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
11 | TRIS | [U-100% 2H] | 10 mM | |
12 | sodium chloride | natural abundance | 300 mM | |
13 | ZnSO4 | natural abundance | 10 uM | |
14 | DTT | [U-100% 2H] | 10 mM | |
15 | sodium azide | natural abundance | 0.01 % | |
16 | benzamidine | natural abundance | 10 mM | |
17 | D2O | [U-100% 2H] | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
11 | TRIS | [U-100% 2H] | 10 mM | |
12 | sodium chloride | natural abundance | 300 mM | |
13 | ZnSO4 | natural abundance | 10 uM | |
14 | DTT | [U-100% 2H] | 10 mM | |
15 | sodium azide | natural abundance | 0.01 % | |
16 | benzamidine | natural abundance | 10 mM | |
17 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | 30S ribosomal protein S27A | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | [U-100% 2H] | 10 mM | |
6 | sodium azide | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | [U-100% 2H] | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15811_2k4x.nef |
Input source #2: Coordindates | 2k4x.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:21:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:24:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:39:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:42:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
Sequence alignments
--------10--------20--------30--------40--------50----- MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS ||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 55 | 0 | 0 | 100.0 |
Content subtype: combined_15811_2k4x.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50----- MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS ||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 355 | 316 | 89.0 |
13C chemical shifts | 255 | 224 | 87.8 |
15N chemical shifts | 60 | 51 | 85.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 113 | 110 | 97.3 |
13C chemical shifts | 110 | 104 | 94.5 |
15N chemical shifts | 53 | 51 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 242 | 206 | 85.1 |
13C chemical shifts | 145 | 120 | 82.8 |
15N chemical shifts | 7 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 18 | 18 | 100.0 |
13C chemical shifts | 18 | 17 | 94.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 25 | 80.6 |
13C chemical shifts | 31 | 14 | 45.2 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50----- MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS | |||||||| |||||||||||||||||||||||||||||||||||||||| M..RELYEIAD.KLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKK --------10--------20--------30--------40--------50--
Dihedral angle restraints
--------10--------20--------30--------40--------50----- MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS |||||||||||| |||||||||| |||||| .................HRFCPRCGPGVF.AEHADRYSCG..GYTEFK --------10--------20--------30--------40--------