SOLUTION NMR STRUCTURE OF SAG0934 from Streptococcus agalactiae. NORTHEAST STRUCTURAL GENOMICS TARGET SaR32[1-108].
MMRLANGIVL DKDTTFGELK FSALRREVRI QNEDGSVSDE IKERTYDLKS KGQGRMIQVS IPASVPLKEF DYNARVELIN PIADTVATAT YQGADVDWYI KADDIVLTLE HHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.0 % (1238 of 1346) | 91.2 % (635 of 696) | 92.6 % (489 of 528) | 93.4 % (114 of 122) |
Backbone | 92.5 % (638 of 690) | 90.6 % (213 of 235) | 93.6 % (320 of 342) | 92.9 % (105 of 113) |
Sidechain | 91.8 % (703 of 766) | 91.5 % (422 of 461) | 91.9 % (272 of 296) | 100.0 % (9 of 9) |
Aromatic | 69.4 % (68 of 98) | 67.3 % (33 of 49) | 70.8 % (34 of 48) | 100.0 % (1 of 1) |
Methyl | 99.3 % (139 of 140) | 98.6 % (69 of 70) | 100.0 % (70 of 70) |
1. SaR32
MMRLANGIVL DKDTTFGELK FSALRREVRI QNEDGSVSDE IKERTYDLKS KGQGRMIQVS IPASVPLKEF DYNARVELIN PIADTVATAT YQGADVDWYI KADDIVLTLE HHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 100 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details N15-labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | SaR32 | [U-5% 13C; U-100% 15N] | 0.57 mM | |
17 | MES | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 100 mM | |
19 | DTT | natural abundance | 10 mM | |
20 | calcium chloride | natural abundance | 5 mM | |
21 | sodium azide | natural abundance | 0.02 % | |
22 | D2O | [U-100% 2H] | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details N15-labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | SaR32 | [U-5% 13C; U-100% 15N] | 0.57 mM | |
17 | MES | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 100 mM | |
19 | DTT | natural abundance | 10 mM | |
20 | calcium chloride | natural abundance | 5 mM | |
21 | sodium azide | natural abundance | 0.02 % | |
22 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details N15-labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | SaR32 | [U-5% 13C; U-100% 15N] | 0.57 mM | |
17 | MES | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 100 mM | |
19 | DTT | natural abundance | 10 mM | |
20 | calcium chloride | natural abundance | 5 mM | |
21 | sodium azide | natural abundance | 0.02 % | |
22 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details N15-labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | SaR32 | [U-5% 13C; U-100% 15N] | 0.57 mM | |
17 | MES | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 100 mM | |
19 | DTT | natural abundance | 10 mM | |
20 | calcium chloride | natural abundance | 5 mM | |
21 | sodium azide | natural abundance | 0.02 % | |
22 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details N15-labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | SaR32 | [U-5% 13C; U-100% 15N] | 0.57 mM | |
17 | MES | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 100 mM | |
19 | DTT | natural abundance | 10 mM | |
20 | calcium chloride | natural abundance | 5 mM | |
21 | sodium azide | natural abundance | 0.02 % | |
22 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in water
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | calcium chloride | natural abundance | 5 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | [U-100% 2H] | 5 % |
Bruker Avance - 800 MHz 5mm TXI RT probe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 K, pH 6.5, Details CN-double labeled SaR32 NMR sample in D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | SaR32 | [U-100% 13C; U-100% 15N] | 0.46 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 10 mM | |
13 | calcium chloride | natural abundance | 5 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | D2O | [U-100% 2H] | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15829_2k5d.nef |
Input source #2: Coordindates | 2k5d.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYI -------110------ KADDIVLTLEHHHHHH |||||||||||||||| KADDIVLTLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 116 | 0 | 0 | 100.0 |
Content subtype: combined_15829_2k5d.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110------ KADDIVLTLEHHHHHH |||||||||| KADDIVLTLE -------110
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
6 | ASN | CG | 176.798 |
31 | GLN | CD | 180.369 |
32 | ASN | CG | 175.983 |
46 | TYR | HH | 10.81 |
53 | GLN | CD | 178.956 |
58 | GLN | CD | 179.75 |
73 | ASN | CG | 176.901 |
80 | ASN | CG | 177.66 |
92 | GLN | CD | 180.499 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 696 | 651 | 93.5 |
13C chemical shifts | 528 | 494 | 93.6 |
15N chemical shifts | 129 | 117 | 90.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 235 | 221 | 94.0 |
13C chemical shifts | 232 | 219 | 94.4 |
15N chemical shifts | 113 | 105 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 461 | 430 | 93.3 |
13C chemical shifts | 296 | 275 | 92.9 |
15N chemical shifts | 16 | 12 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 70 | 95.9 |
13C chemical shifts | 73 | 70 | 95.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 37 | 75.5 |
13C chemical shifts | 48 | 36 | 75.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYI --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110------ KADDIVLTLEHHHHHH |||||||||| KADDIVLTLE -------110
Dihedral angle restraints