SOLUTION NMR STRUCTURE OF the second OB-fold domain of replication protein A from Methanococcus maripaludis. NORTHEAST STRUCTURAL GENOMICS TARGET MrR110B.
MNYKISELMP NLSGTINAEV VAAYPKKEFS RKDGTKGQLK SLFLKDDTGS IRGTLWNELA DFEVKKGDIA EVSGYVKQGY SGLEISVDNI GIIEKSLEHH HHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.8 % (1127 of 1214) | 92.7 % (585 of 631) | 92.6 % (438 of 473) | 94.5 % (104 of 110) |
Backbone | 93.4 % (579 of 620) | 93.5 % (202 of 216) | 93.0 % (281 of 302) | 94.1 % (96 of 102) |
Sidechain | 92.3 % (635 of 688) | 92.3 % (383 of 415) | 92.1 % (244 of 265) | 100.0 % (8 of 8) |
Aromatic | 75.5 % (74 of 98) | 75.5 % (37 of 49) | 75.0 % (36 of 48) | 100.0 % (1 of 1) |
Methyl | 100.0 % (110 of 110) | 100.0 % (55 of 55) | 100.0 % (55 of 55) |
1. MrR110B
MNYKISELMP NLSGTINAEV VAAYPKKEFS RKDGTKGQLK SLFLKDDTGS IRGTLWNELA DFEVKKGDIA EVSGYVKQGY SGLEISVDNI GIIEKSLEHH HHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
8 | MES | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | sodium azide | natural abundance | 0.02 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | MrR110B | [U-5% 13C; U-100% 15N] | 0.94 mM | |
14 | MES | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | sodium azide | natural abundance | 0.02 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 800 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz 5mm CRP
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
8 | MES | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DTT | natural abundance | 10 mM | |
12 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | MrR110B | [U-5% 13C; U-100% 15N] | 0.94 mM | |
14 | MES | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | MrR110B | [U-5% 13C; U-100% 15N] | 0.94 mM | |
14 | MES | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | MrR110B | [U-5% 13C; U-100% 15N] | 0.94 mM | |
14 | MES | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 800 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MrR110B | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % |
Bruker Avance - 600 MHz 5mm CRP
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | MrR110B | [U-5% 13C; U-100% 15N] | 0.94 mM | |
14 | MES | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 100 mM | |
16 | calcium chloride | natural abundance | 5 mM | |
17 | DTT | natural abundance | 10 mM | |
18 | sodium azide | natural abundance | 0.02 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_15849_2k5v.nef |
Input source #2: Coordindates | 2k5v.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------180-------190-------200-------210-------220-------230-------240-------250-------260-------270- MNYKISELMPNLSGTINAEVVAAYPKKEFSRKDGTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKSLEHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MNYKISELMPNLSGTINAEVVAAYPKKEFSRKDGTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKSLEHH --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---- HHHH |||| HHHH ----
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 104 | 0 | 0 | 100.0 |
Content subtype: combined_15849_2k5v.nef
Assigned chemical shifts
------180-------190-------200-------210-------220-------230-------240-------250-------260-------270- MNYKISELMPNLSGTINAEVVAAYPKKEFSRKDGTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKSLEHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MNYKISELMPNLSGTINAEVVAAYPKKEFSRKDGTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKSLE ------180-------190-------200-------210-------220-------230-------240-------250-------260--------- ---- HHHH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
173 | ASN | CG | 176.802 |
182 | ASN | CG | 178.798 |
188 | ASN | CG | 176.69 |
209 | GLN | CD | 180.064 |
228 | ASN | CG | 176.924 |
249 | GLN | CD | 179.673 |
260 | ASN | CG | 176.738 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 631 | 594 | 94.1 |
13C chemical shifts | 473 | 443 | 93.7 |
15N chemical shifts | 112 | 105 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 216 | 203 | 94.0 |
13C chemical shifts | 208 | 196 | 94.2 |
15N chemical shifts | 102 | 95 | 93.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 415 | 391 | 94.2 |
13C chemical shifts | 265 | 247 | 93.2 |
15N chemical shifts | 10 | 10 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 57 | 100.0 |
13C chemical shifts | 57 | 57 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 49 | 37 | 75.5 |
13C chemical shifts | 48 | 36 | 75.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
------180-------190-------200-------210-------220-------230-------240-------250-------260-------270- MNYKISELMPNLSGTINAEVVAAYPKKEFSRKDGTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKSLEHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MNYKISELMPNLSGTINAEVVAAYPKKEFSRKDGTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKSLE ------180-------190-------200-------210-------220-------230-------240-------250-------260--------- ---- HHHH
Dihedral angle restraints
------180-------190-------200-------210-------220-------230-------240-------250-------260-------270- MNYKISELMPNLSGTINAEVVAAYPKKEFSRKDGTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGYSGLEISVDNIGIIEKSLEHH |||||||||||||||||||||||| |||||||| |||||||||| ||||||||||||||||||| |||||||||||| ||||||||||| MNYKISELMPNLSGTINAEVVAAY.KKEFSRKD...GQLKSLFLKD.TGSIRGTLWNELADFEVKK.DIAEVSGYVKQG...LEISVDNIGII ------180-------190-------200-------210-------220-------230-------240-------250-------260---- ---- HHHH