NMR assignments of juvenile hormone binding protein in complex with JH III
GSDGDALLKP CKLGDMQCLS SATEQFLEKT SKGIPQYDIW PIDPLVVTSL DVIAPSDAGI VIRFKNLNIT GLKNQQISDF QMDTKAKTVL LKTKADLHIV GDIVIELTEQ SKSFTGLYTA DTNVIGAVRY GYNLKNDDNG VQHFEVQPET FTCESIGEPK ITLSSDLSSA LEKDSGNNSL EPDMEPLKTL RQAAICKIAE ACYISVVHNI RASAKILPAS SFFENLN
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS11:SG | 1:CYS18:SG |
2 | disulfide | sing | 1:CYS153:SG | 1:CYS196:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 98.2 % (2548 of 2595) | 97.5 % (1307 of 1341) | 99.0 % (1004 of 1014) | 98.8 % (237 of 240) |
Backbone | 98.3 % (1319 of 1342) | 97.4 % (445 of 457) | 99.0 % (661 of 668) | 98.2 % (213 of 217) |
Sidechain | 96.9 % (1422 of 1467) | 96.5 % (853 of 884) | 97.5 % (546 of 560) | 100.0 % (23 of 23) |
Aromatic | 91.7 % (132 of 144) | 91.7 % (66 of 72) | 91.5 % (65 of 71) | 100.0 % (1 of 1) |
Methyl | 98.2 % (277 of 282) | 97.9 % (138 of 141) | 98.6 % (139 of 141) |
1. hJHBP
GSDGDALLKP CKLGDMQCLS SATEQFLEKT SKGIPQYDIW PIDPLVVTSL DVIAPSDAGI VIRFKNLNIT GLKNQQISDF QMDTKAKTVL LKTKADLHIV GDIVIELTEQ SKSFTGLYTA DTNVIGAVRY GYNLKNDDNG VQHFEVQPET FTCESIGEPK ITLSSDLSSA LEKDSGNNSL EPDMEPLKTL RQAAICKIAE ACYISVVHNI RASAKILPAS SFFENLNSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hJHBP | [U-15N] | 0.6-1.0 mM | |
2 | JH III | natural abundance | 0.6-1.0 mM | |
3 | sodium phosphate | natural abundance | 45 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | hJHBP | [U-13C; U-15N] | 0.6-1.0 mM | |
7 | JH III | natural abundance | 0.6-1.0 mM | |
8 | sodium phosphate | natural abundance | 45 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hJHBP | [U-13C; U-15N] | 0.6-1.0 mM | |
12 | JH III | natural abundance | 0.6-1.0 mM | |
13 | sodium phosphate | natural abundance | 45 mM | |
14 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbons | 0.0 ppm | external | direct | 1.0 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | ammonium hydroxide | nitrogen | 0.0 ppm | external | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbons | 0.0 ppm | external | direct | 1.0 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | ammonium hydroxide | nitrogen | 0.0 ppm | external | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbons | 0.0 ppm | external | direct | 1.0 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | ammonium hydroxide | nitrogen | 0.0 ppm | external | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | TSP | methyl carbons | 0.0 ppm | external | direct | 1.0 |
1H | TSP | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | ammonium hydroxide | nitrogen | 0.0 ppm | external | direct | 1.0 |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hJHBP | [U-15N] | 0.6-1.0 mM | |
2 | JH III | natural abundance | 0.6-1.0 mM | |
3 | sodium phosphate | natural abundance | 45 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hJHBP | [U-13C; U-15N] | 0.6-1.0 mM | |
12 | JH III | natural abundance | 0.6-1.0 mM | |
13 | sodium phosphate | natural abundance | 45 mM | |
14 | D2O | natural abundance | 100 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | hJHBP | [U-13C; U-15N] | 0.6-1.0 mM | |
7 | JH III | natural abundance | 0.6-1.0 mM | |
8 | sodium phosphate | natural abundance | 45 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | hJHBP | [U-13C; U-15N] | 0.6-1.0 mM | |
7 | JH III | natural abundance | 0.6-1.0 mM | |
8 | sodium phosphate | natural abundance | 45 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | hJHBP | [U-13C; U-15N] | 0.6-1.0 mM | |
7 | JH III | natural abundance | 0.6-1.0 mM | |
8 | sodium phosphate | natural abundance | 45 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hJHBP | [U-13C; U-15N] | 0.6-1.0 mM | |
12 | JH III | natural abundance | 0.6-1.0 mM | |
13 | sodium phosphate | natural abundance | 45 mM | |
14 | D2O | natural abundance | 100 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hJHBP | [U-13C; U-15N] | 0.6-1.0 mM | |
12 | JH III | natural abundance | 0.6-1.0 mM | |
13 | sodium phosphate | natural abundance | 45 mM | |
14 | D2O | natural abundance | 100 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hJHBP | [U-15N] | 0.6-1.0 mM | |
2 | JH III | natural abundance | 0.6-1.0 mM | |
3 | sodium phosphate | natural abundance | 45 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hJHBP | [U-15N] | 0.6-1.0 mM | |
2 | JH III | natural abundance | 0.6-1.0 mM | |
3 | sodium phosphate | natural abundance | 45 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hJHBP | [U-13C; U-15N] | 0.6-1.0 mM | |
12 | JH III | natural abundance | 0.6-1.0 mM | |
13 | sodium phosphate | natural abundance | 45 mM | |
14 | D2O | natural abundance | 100 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hJHBP | [U-13C; U-15N] | 0.6-1.0 mM | |
12 | JH III | natural abundance | 0.6-1.0 mM | |
13 | sodium phosphate | natural abundance | 45 mM | |
14 | D2O | natural abundance | 100 % |
Bruker DMX - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 308 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | hJHBP | [U-13C; U-15N] | 0.6-1.0 mM | |
12 | JH III | natural abundance | 0.6-1.0 mM | |
13 | sodium phosphate | natural abundance | 45 mM | |
14 | D2O | natural abundance | 100 % |
Properties
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:11:CYS:SG | 1:18:CYS:SG | oxidized, CA 51.792, CB 42.786 ppm | oxidized, CA 59.964, CB 37.519 ppm | n/a |
1:153:CYS:SG | 1:196:CYS:SG | oxidized, CA 52.662, CB 40.786 ppm | oxidized, CA 57.588, CB 37.131 ppm | n/a |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr16021_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GSDGDALLKPCKLGDMQCLSSATEQFLEKTSKGIPQYDIWPIDPLVVTSLDVIAPSDAGIVIRFKNLNITGLKNQQISDFQMDTKAKTVLLKTKADLHIV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSDGDALLKPCKLGDMQCLSSATEQFLEKTSKGIPQYDIWPIDPLVVTSLDVIAPSDAGIVIRFKNLNITGLKNQQISDFQMDTKAKTVLLKTKADLHIV -------110-------120-------130-------140-------150-------160-------170-------180-------190-------200 GDIVIELTEQSKSFTGLYTADTNVIGAVRYGYNLKNDDNGVQHFEVQPETFTCESIGEPKITLSSDLSSALEKDSGNNSLEPDMEPLKTLRQAAICKIAE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GDIVIELTEQSKSFTGLYTADTNVIGAVRYGYNLKNDDNGVQHFEVQPETFTCESIGEPKITLSSDLSSALEKDSGNNSLEPDMEPLKTLRQAAICKIAE -------210-------220------- ACYISVVHNIRASAKILPASSFFENLN ||||||||||||||||||||||||||| ACYISVVHNIRASAKILPASSFFENLN
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
3 | ASP | CG | 177.807 |
5 | ASP | CG | 179.932 |
15 | ASP | CG | 181.092 |
17 | GLN | CD | 180.151 |
24 | GLU | CD | 183.349 |
25 | GLN | CD | 179.584 |
28 | GLU | CD | 182.932 |
36 | GLN | CD | 180.217 |
38 | ASP | CG | 181.689 |
43 | ASP | CG | 180.321 |
51 | ASP | CG | 178.886 |
57 | ASP | CG | 177.767 |
66 | ASN | CG | 178.397 |
68 | ASN | CG | 176.226 |
74 | ASN | CG | 177.07 |
75 | GLN | CD | 178.525 |
76 | GLN | CD | 180.512 |
79 | ASP | CG | 178.599 |
81 | GLN | CD | 179.859 |
83 | ASP | CG | 180.499 |
96 | ASP | CG | 180.367 |
102 | ASP | CG | 175.97 |
106 | GLU | CD | 182.912 |
109 | GLU | CD | 183.138 |
110 | GLN | CD | 179.473 |
121 | ASP | CG | 180.899 |
123 | ASN | CG | 176.592 |
133 | ASN | CG | 175.98 |
136 | ASN | CG | 175.414 |
137 | ASP | CG | 179.673 |
138 | ASP | CG | 179.813 |
139 | ASN | CG | 177.327 |
142 | GLN | CD | 179.111 |
145 | GLU | CD | 183.039 |
147 | GLN | CD | 179.175 |
149 | GLU | CD | 182.724 |
154 | GLU | CD | 181.774 |
158 | GLU | CD | 184.276 |
166 | ASP | CG | 179.508 |
172 | GLU | CD | 182.272 |
174 | ASP | CG | 179.153 |
177 | ASN | CG | 176.916 |
178 | ASN | CG | 177.142 |
181 | GLU | CD | 182.932 |
183 | ASP | CG | 180.559 |
185 | GLU | CD | 181.699 |
192 | GLN | CD | 179.752 |
200 | GLU | CD | 184.276 |
224 | GLU | CD | 182.15 |
225 | ASN | CG | 178.132 |
227 | ASN | CG | 178.159 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1341 | 1313 | 97.9 |
13C chemical shifts | 1014 | 997 | 98.3 |
15N chemical shifts | 244 | 242 | 99.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 457 | 455 | 99.6 |
13C chemical shifts | 454 | 453 | 99.8 |
15N chemical shifts | 217 | 215 | 99.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 884 | 858 | 97.1 |
13C chemical shifts | 560 | 544 | 97.1 |
15N chemical shifts | 27 | 27 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 144 | 144 | 100.0 |
13C chemical shifts | 144 | 144 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 64 | 88.9 |
13C chemical shifts | 71 | 63 | 88.7 |
15N chemical shifts | 1 | 1 | 100.0 |