Structure of E. coli toxin RelE(R81A/R83A) mutant in the free state
GSHMAYFLDF DERALKEWRK LGSTVREQLK KKLVEVLESP RIEANKLRGM PDCYKIKLRS SGYRLVYQVI DEKVVVFVIS VGKAEASEVY SEAVKRIL
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.0 % (1103 of 1199) | 95.2 % (599 of 629) | 87.2 % (410 of 470) | 94.0 % (94 of 100) |
Backbone | 94.0 % (549 of 584) | 94.5 % (188 of 199) | 93.8 % (271 of 289) | 93.8 % (90 of 96) |
Sidechain | 91.0 % (644 of 708) | 95.6 % (411 of 430) | 83.6 % (229 of 274) | 100.0 % (4 of 4) |
Aromatic | 43.0 % (37 of 86) | 83.7 % (36 of 43) | 0.0 % (0 of 42) | 100.0 % (1 of 1) |
Methyl | 100.0 % (122 of 122) | 100.0 % (61 of 61) | 100.0 % (61 of 61) |
1. RelE
GSHMAYFLDF DERALKEWRK LGSTVREQLK KKLVEVLESP RIEANKLRGM PDCYKIKLRS SGYRLVYQVI DEKVVVFVIS VGKAEASEVY SEAVKRILSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296.5 (±0.1) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RelE | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.5 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 296.5 (±0.1) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | RelE | [U-13C; U-15N] | 0.5 (±0.1) mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium chloride | natural abundance | 500 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296.5 (±0.1) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RelE | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296.5 (±0.1) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RelE | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.5 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296.5 (±0.1) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RelE | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.5 mM |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296.5 (±0.1) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RelE | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296.5 (±0.1) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RelE | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296.5 (±0.1) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RelE | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 296.5 (±0.1) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | RelE | [U-13C; U-15N] | 0.5 (±0.1) mM | |
2 | sodium phosphate | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | DTT | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 296.5 (±0.1) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | RelE | [U-13C; U-15N] | 0.5 (±0.1) mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium chloride | natural abundance | 500 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 296.5 (±0.1) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | RelE | [U-13C; U-15N] | 0.5 (±0.1) mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium chloride | natural abundance | 500 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 296.5 (±0.1) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | RelE | [U-13C; U-15N] | 0.5 (±0.1) mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium chloride | natural abundance | 500 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.5 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 296.5 (±0.1) K, pH 6.5 (±0.05)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | RelE | [U-13C; U-15N] | 0.5 (±0.1) mM | |
7 | sodium phosphate | natural abundance | 25 mM | |
8 | sodium chloride | natural abundance | 500 mM | |
9 | DTT | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16066_2kc9.nef |
Input source #2: Coordindates | 2kc9.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------10--------20--------30--------40--------50--------60--------70--------80--------90----- GSHMAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKAEASEVYSEAVKRIL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKAEASEVYSEAVKRIL --------10--------20--------30--------40--------50--------60--------70--------80--------90--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 98 | 0 | 0 | 100.0 |
Content subtype: combined_16066_2kc9.nef
Assigned chemical shifts
-----------10--------20--------30--------40--------50--------60--------70--------80--------90----- GSHMAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKAEASEVYSEAVKRIL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKAEASEVYSEAVKRIL
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 629 | 600 | 95.4 |
13C chemical shifts | 470 | 409 | 87.0 |
15N chemical shifts | 108 | 94 | 87.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 199 | 189 | 95.0 |
13C chemical shifts | 196 | 180 | 91.8 |
15N chemical shifts | 96 | 90 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 430 | 411 | 95.6 |
13C chemical shifts | 274 | 229 | 83.6 |
15N chemical shifts | 12 | 4 | 33.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 63 | 100.0 |
13C chemical shifts | 63 | 63 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 43 | 36 | 83.7 |
13C chemical shifts | 42 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
-----------10--------20--------30--------40--------50--------60--------70--------80--------90----- GSHMAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKAEASEVYSEAVKRIL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKAEASEVYSEAVKRIL
-----------10--------20--------30--------40--------50--------60--------70--------80--------90----- GSHMAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKAEASEVYSEAVKRIL | | | ||||||||| |||||||||||||||| | | | | ||| ||||||| ||||||| | ......F.D.D.RALKEWRKL.STVREQLKKKLVEVLE.P.I..N......D.YKI.......RLVYQVI...VVVFVIS.G -----------10--------20--------30--------40--------50--------60--------70---------
Dihedral angle restraints
-----------10--------20--------30--------40--------50--------60--------70--------80--------90----- GSHMAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKAEASEVYSEAVKRIL ||||||||||||||| ||||||||||||||||| ||||||| ||||||| |||||||||||||||||||||| ||||||||||| ......FLDFDERALKEWRKL.STVREQLKKKLVEVLES.RIEANKL....DCYKIKL....YRLVYQVIDEKVVVFVISVGKA..SEVYSEAVKRI -----------10--------20--------30--------40--------50--------60--------70--------80--------90----