Solution NMR structure of ribosomal protein sso0164 from Sulfolobus solfataricus. NortheastStructural Genomics Consortium (NESG) target SsT4
MGFYQGPDNR KITGGLKGKH RDKRKYEIGN PPTFTTLSAE DIRIKDRTLG GNFKVRLKYT TTANVLDPAT NTAKKVKILE ILETPANKEL ARRGIIIRGA KIRTEAGLAV VTSRPGQDGV INAVLLKNES QRS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.8 % (1303 of 1554) | 84.0 % (687 of 818) | 83.3 % (498 of 598) | 85.5 % (118 of 138) |
Backbone | 86.9 % (683 of 786) | 88.3 % (241 of 273) | 86.8 % (335 of 386) | 84.3 % (107 of 127) |
Sidechain | 81.5 % (724 of 888) | 81.5 % (444 of 545) | 81.3 % (270 of 332) | 90.9 % (10 of 11) |
Aromatic | 55.2 % (32 of 58) | 72.4 % (21 of 29) | 37.9 % (11 of 29) | |
Methyl | 91.4 % (148 of 162) | 91.4 % (74 of 81) | 91.4 % (74 of 81) |
1. sso0164
MGFYQGPDNR KITGGLKGKH RDKRKYEIGN PPTFTTLSAE DIRIKDRTLG GNFKVRLKYT TTANVLDPAT NTAKKVKILE ILETPANKEL ARRGIIIRGA KIRTEAGLAV VTSRPGQDGV INAVLLKNES QRSSolvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sso0164 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Pressure 1.0 atm, Temperature 298 K, pH 7.7
Experiment name 2D 1H-15N HSQC(IPAP)
List #1 RDC_list_1, RDC code DHN, Field strength (1H) 800 MHz
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sso0164 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sso0164 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sso0164 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sso0164 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sso0164 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sso0164 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sso0164 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sso0164 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sso0164 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sso0164 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sso0164 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM |
Bruker Avance - 800 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1.0 atm, Temperature 298 K, pH 7.7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sso0164 | [U-13C; U-15N] | 0.5 mM | |
2 | TRIS | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 500 mM | |
4 | ZnSO4 | natural abundance | 10 uM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.01 % | |
7 | benzamidine | natural abundance | 10 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16089_2kco.nef |
Input source #2: Coordindates | 2kco.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGFYQGPDNRKITGGLKGKHRDKRKYEIGNPPTFTTLSAEDIRIKDRTLGGNFKVRLKYTTTANVLDPATNTAKKVKILEILETPANKELARRGIIIRGA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGFYQGPDNRKITGGLKGKHRDKRKYEIGNPPTFTTLSAEDIRIKDRTLGGNFKVRLKYTTTANVLDPATNTAKKVKILEILETPANKELARRGIIIRGA -------110-------120-------130--- KIRTEAGLAVVTSRPGQDGVINAVLLKNESQRS ||||||||||||||||||||||||||||||||| KIRTEAGLAVVTSRPGQDGVINAVLLKNESQRS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 133 | 0 | 0 | 100.0 |
Content subtype: combined_16089_2kco.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGFYQGPDNRKITGGLKGKHRDKRKYEIGNPPTFTTLSAEDIRIKDRTLGGNFKVRLKYTTTANVLDPATNTAKKVKILEILETPANKELARRGIIIRGA ||||||||||||||||||||||||||||||||||||||||||||||||||||| || |||||||||||||||||||||||||||||||||||||||||| MGFYQGPDNRKITGGLKGKHRDKRKYEIGNPPTFTTLSAEDIRIKDRTLGGNF.VR..YTTTANVLDPATNTAKKVKILEILETPANKELARRGIIIRGA -------110-------120-------130--- KIRTEAGLAVVTSRPGQDGVINAVLLKNESQRS |||||||||||||| |||||||||||||||| | KIRTEAGLAVVTSR.GQDGVINAVLLKNESQ.S
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 818 | 669 | 81.8 |
13C chemical shifts | 598 | 478 | 79.9 |
15N chemical shifts | 150 | 112 | 74.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 273 | 234 | 85.7 |
13C chemical shifts | 266 | 215 | 80.8 |
15N chemical shifts | 127 | 102 | 80.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 545 | 435 | 79.8 |
13C chemical shifts | 332 | 263 | 79.2 |
15N chemical shifts | 23 | 10 | 43.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 74 | 90.2 |
13C chemical shifts | 82 | 74 | 90.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 29 | 21 | 72.4 |
13C chemical shifts | 29 | 11 | 37.9 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGFYQGPDNRKITGGLKGKHRDKRKYEIGNPPTFTTLSAEDIRIKDRTLGGNFKVRLKYTTTANVLDPATNTAKKVKILEILETPANKELARRGIIIRGA ||||| || || ||||| |||||||||||||||||||||||||||||| || || ||||||||||||||||||||||||||||||||||||||||| ..FYQGP.NR.IT.GLKGK.RDKRKYEIGNPPTFTTLSAEDIRIKDRTLG.NF.VR...TTTANVLDPATNTAKKVKILEILETPANKELARRGIIIRGA --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130--- KIRTEAGLAVVTSRPGQDGVINAVLLKNESQRS |||||||||||||| |||||||||||||| KIRTEAGLAVVTSR..QDGVINAVLLKNES -------110-------120-------130
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGFYQGPDNRKITGGLKGKHRDKRKYEIGNPPTFTTLSAEDIRIKDRTLGGNFKVRLKYTTTANVLDPATNTAKKVKILEILETPANKELARRGIIIRGA |||| ||| ||| |||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||| ........NRKI................GNP..FTT.SAEDIRIKDRTL.GNFKVRLKYTTTANVLDPATNTAKKVKILEILETPANKELARRGIIIRGA --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130--- KIRTEAGLAVVTSRPGQDGVINAVLLKNESQRS |||||||||||||| ||||||||||| KIRTEAGLAVVTSR.GQDGVINAVLL -------110-------120------
RDC restraints