Chemical shift assignments of the second domain of the listeria protein Lin2157, Northeast Structural Genomics Consortium target Lkr136b
MVKVTYDGVY VLSVKEDVPA AGILHAGDLI TEIDGQSFKS SQEFIDYIHS KKVGDTVKIK YKHGNKNEEA SIKLTAIDKK GTPGIGITLV DDLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.8 % (930 of 1151) | 73.3 % (434 of 592) | 88.2 % (403 of 457) | 91.2 % (93 of 102) |
Backbone | 94.1 % (561 of 596) | 92.8 % (192 of 207) | 94.8 % (276 of 291) | 94.9 % (93 of 98) |
Sidechain | 70.7 % (457 of 646) | 62.9 % (242 of 385) | 83.7 % (215 of 257) | 0.0 % (0 of 4) |
Aromatic | 40.9 % (36 of 88) | 43.2 % (19 of 44) | 38.6 % (17 of 44) | |
Methyl | 87.7 % (107 of 122) | 86.9 % (53 of 61) | 88.5 % (54 of 61) |
1. lkr136b
MVKVTYDGVY VLSVKEDVPA AGILHAGDLI TEIDGQSFKS SQEFIDYIHS KKVGDTVKIK YKHGNKNEEA SIKLTAIDKK GTPGIGITLV DDLEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lkr136b | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | sodium acetate | natural abundance | 20 mM | |
6 | calcium chloride | natural abundance | 5 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | lkr136b | [U-100% 13C; U-100% 15N] | 1.18 mM | |
10 | pentaethylene glycol monododecyl ether | natural abundance | 4 % | |
11 | sodium chloride | natural abundance | 200 mM | |
12 | sodium azide | natural abundance | 0.02 % | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium acetate | natural abundance | 20 mM | |
15 | calcium chloride | natural abundance | 5 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298 K, pH 4.5
Experiment name 2D HSQC/TROSY
List #1 RDC_list_1, RDC code DHN, Field strength (1H) 600 MHz
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lkr136b | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | sodium acetate | natural abundance | 20 mM | |
6 | calcium chloride | natural abundance | 5 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lkr136b | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | sodium acetate | natural abundance | 20 mM | |
6 | calcium chloride | natural abundance | 5 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lkr136b | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | sodium acetate | natural abundance | 20 mM | |
6 | calcium chloride | natural abundance | 5 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lkr136b | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | sodium acetate | natural abundance | 20 mM | |
6 | calcium chloride | natural abundance | 5 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lkr136b | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | sodium acetate | natural abundance | 20 mM | |
6 | calcium chloride | natural abundance | 5 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lkr136b | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | sodium acetate | natural abundance | 20 mM | |
6 | calcium chloride | natural abundance | 5 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lkr136b | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | sodium acetate | natural abundance | 20 mM | |
6 | calcium chloride | natural abundance | 5 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | lkr136b | [U-100% 13C; U-100% 15N] | 1.18 mM | |
2 | DTT | natural abundance | 10 mM | |
3 | sodium azide | natural abundance | 0.02 % | |
4 | sodium chloride | natural abundance | 200 mM | |
5 | sodium acetate | natural abundance | 20 mM | |
6 | calcium chloride | natural abundance | 5 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | lkr136b | [U-100% 13C; U-100% 15N] | 1.18 mM | |
10 | pentaethylene glycol monododecyl ether | natural abundance | 4 % | |
11 | sodium chloride | natural abundance | 200 mM | |
12 | sodium azide | natural abundance | 0.02 % | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium acetate | natural abundance | 20 mM | |
15 | calcium chloride | natural abundance | 5 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16325_2kjk.nef |
Input source #2: Coordindates | 2kjk.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVKVTYDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGITLVDDLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVKVTYDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGITLVDDLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 100 | 0 | 0 | 100.0 |
Content subtype: combined_16325_2kjk.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVKVTYDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGITLVDDLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVKVTYDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGITLVDDLEHH --------10--------20--------30--------40--------50--------60--------70--------80--------90------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 592 | 416 | 70.3 |
13C chemical shifts | 457 | 395 | 86.4 |
15N chemical shifts | 102 | 92 | 90.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 207 | 189 | 91.3 |
13C chemical shifts | 200 | 185 | 92.5 |
15N chemical shifts | 98 | 92 | 93.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 385 | 227 | 59.0 |
13C chemical shifts | 257 | 210 | 81.7 |
15N chemical shifts | 4 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 52 | 83.9 |
13C chemical shifts | 62 | 54 | 87.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 13 | 29.5 |
13C chemical shifts | 44 | 13 | 29.5 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVKVTYDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGITLVDDLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..KVTYDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGITLVDDLEH --------10--------20--------30--------40--------50--------60--------70--------80--------90-----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVKVTYDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGITLVDDLEHHHHHH |||||||| ||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||| |||||| ||| .......GVYVLSVK...PAAGILHAGDLITEIDGQS..SSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTP..GITLVD..EHH --------10--------20--------30--------40--------50--------60--------70--------80--------90------
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVKVTYDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGITLVDDLEHHHHHH |||||||||||| ||| |||| || | ||| || || |||||||||||||||||||||||||||||||| | ||||||||| ......DGVYVLSVKEDV..AGI.HAGD.IT..D.....SSQ.FI.YI.SKKVGDTVKIKYKHGNKNEEASIKLTAIDKKG..G.GITLVDDLE --------10--------20--------30--------40--------50--------60--------70--------80--------90----