Solution structure of At3g03773.1 protein from Arabidopsis thaliana
SSRNPEVLWA QRSDKVYLTV ALPDAKDISV KCEPQGLFSF SALGAQGERF EFSLELYGKI MTEYRKNVGL RNIIFSIQKE ERSWWTRLLK SEEKPAPYIK VDWNKWCDED EEVNSETASD DESAFVNQDS ESSDDDGLLY LPDLEKARNK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.0 % (1710 of 1782) | 95.7 % (894 of 934) | 98.1 % (674 of 687) | 88.2 % (142 of 161) |
Backbone | 97.3 % (864 of 888) | 97.3 % (292 of 300) | 97.3 % (432 of 444) | 97.2 % (140 of 144) |
Sidechain | 95.3 % (989 of 1038) | 95.0 % (602 of 634) | 99.5 % (385 of 387) | 11.8 % (2 of 17) |
Aromatic | 97.5 % (156 of 160) | 100.0 % (80 of 80) | 100.0 % (75 of 75) | 20.0 % (1 of 5) |
Methyl | 100.0 % (138 of 138) | 100.0 % (69 of 69) | 100.0 % (69 of 69) |
1. At3g03773.1
SSRNPEVLWA QRSDKVYLTV ALPDAKDISV KCEPQGLFSF SALGAQGERF EFSLELYGKI MTEYRKNVGL RNIIFSIQKE ERSWWTRLLK SEEKPAPYIK VDWNKWCDED EEVNSETASD DESAFVNQDS ESSDDDGLLY LPDLEKARNKSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 7.0 (±0.2)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-13C; U-15N] | 1 (±0.1) mM | |
2 | H2O | natural abundance | 93 % | |
3 | H2O | natural abundance | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16442_2kmw.nef |
Input source #2: Coordindates | 2kmw.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIK -------110-------120-------130-------140-------150 VDWNKWCDEDEEVNSETASDDESAFVNQDSESSDDDGLLYLPDLEKARNK |||||||||||||||||||||||||||||||||||||||||||||||||| VDWNKWCDEDEEVNSETASDDESAFVNQDSESSDDDGLLYLPDLEKARNK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 150 | 0 | 0 | 100.0 |
Content subtype: combined_16442_2kmw.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIK -------110-------120-------130-------140-------150 VDWNKWCDEDEEVNSETASDDESAFVNQDSESSDDDGLLYLPDLEKARNK |||||||||||||||||||||||||||||||||||||||||||||||||| VDWNKWCDEDEEVNSETASDDESAFVNQDSESSDDDGLLYLPDLEKARNK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 934 | 913 | 97.8 |
13C chemical shifts | 687 | 671 | 97.7 |
15N chemical shifts | 169 | 140 | 82.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 300 | 299 | 99.7 |
13C chemical shifts | 300 | 285 | 95.0 |
15N chemical shifts | 144 | 140 | 97.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 634 | 614 | 96.8 |
13C chemical shifts | 387 | 386 | 99.7 |
15N chemical shifts | 25 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 69 | 98.6 |
13C chemical shifts | 70 | 69 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 80 | 80 | 100.0 |
13C chemical shifts | 75 | 75 | 100.0 |
15N chemical shifts | 5 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150 VDWNKWCDEDEEVNSETASDDESAFVNQDSESSDDDGLLYLPDLEKARNK ||||||||||||||||||||||||||||||||||||||||||||||||| VDWNKWCDEDEEVNSETASDDESAFVNQDSESSDDDGLLYLPDLEKARN -------110-------120-------130-------140---------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 SSRNPEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRKNVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIK ||||||||||||||||||||| |||||||||| |||||||||||||||||||||||||| |||||||||||||||||| |||||| |||| .SRNPEVLWAQRSDKVYLTVAL..AKDISVKCEP.GLFSFSALGAQGERFEFSLELYGKIM.EYRKNVGLRNIIFSIQKE....WTRLLK......PYIK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150 VDWNKWCDEDEEVNSETASDDESAFVNQDSESSDDDGLLYLPDLEKARNK ||||||||| VDWNKWCDE ---------