Solution NMR structure of CLOLEP_01837 (fragment 61-160) from Clostridium leptum. Northeast Structural Genomics Consortium Target QlR8A.
RDSFGDWAEK FLKSKEADGV SVSQLNSYKN YCRNHLSPLY MKSLSEILPA DIQSIINETK LAKNTLKAIR NTASQIFRLA IENRAIDFNP ADYVRIPKIA LEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.7 % (1216 of 1298) | 93.7 % (635 of 678) | 93.1 % (469 of 504) | 96.6 % (112 of 116) |
Backbone | 95.3 % (610 of 640) | 96.3 % (206 of 214) | 94.7 % (305 of 322) | 95.2 % (99 of 104) |
Sidechain | 92.3 % (705 of 764) | 92.5 % (429 of 464) | 91.7 % (264 of 288) | 100.0 % (12 of 12) |
Aromatic | 71.4 % (80 of 112) | 71.4 % (40 of 56) | 70.9 % (39 of 55) | 100.0 % (1 of 1) |
Methyl | 100.0 % (118 of 118) | 100.0 % (59 of 59) | 100.0 % (59 of 59) |
1. QlR8A
RDSFGDWAEK FLKSKEADGV SVSQLNSYKN YCRNHLSPLY MKSLSEILPA DIQSIINETK LAKNTLKAIR NTASQIFRLA IENRAIDFNP ADYVRIPKIA LEHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 200 (±10.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 10 (±0.5) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
15 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 200 (±10.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 10 (±0.5) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
15 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±0.5) K, pH 6.5 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 200 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.9 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16498_2kob.nef |
Input source #2: Coordindates | 2kob.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160 RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIA --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------- LEHHHHHH |||||||| LEHHHHHH --------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 108 | 0 | 0 | 100.0 |
Content subtype: combined_16498_2kob.nef
Assigned chemical shifts
--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160 RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIA -------- LEHHHHHH ||| || LEH...HH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
84 | GLN | CD | 179.9 |
86 | ASN | CG | 175.5 |
90 | ASN | CG | 175.7 |
94 | ASN | CG | 176.4 |
103 | SER | HG | 4.99 |
113 | GLN | CD | 180.5 |
117 | ASN | CG | 176.4 |
124 | ASN | CG | 176.1 |
131 | ASN | CG | 176.2 |
135 | GLN | CD | 180.2 |
143 | ASN | CG | 178.5 |
149 | ASN | CG | 176.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 678 | 626 | 92.3 |
13C chemical shifts | 504 | 464 | 92.1 |
15N chemical shifts | 122 | 113 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 214 | 205 | 95.8 |
13C chemical shifts | 216 | 204 | 94.4 |
15N chemical shifts | 104 | 100 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 464 | 421 | 90.7 |
13C chemical shifts | 288 | 260 | 90.3 |
15N chemical shifts | 18 | 13 | 72.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 59 | 98.3 |
13C chemical shifts | 60 | 59 | 98.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 40 | 71.4 |
13C chemical shifts | 55 | 39 | 70.9 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160 RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIA -------- LEHHHHHH || || LE....HH
--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160 RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIA |||||||||||||||| ||||||||||||| | ||||||||||| ||||||||||||||||||||| || |||||| ..SFGDWAEKFLKSKEAD..SVSQLNSYKNYCR..L............PADIQSIINET..AKNTLKAIRNTASQIFRLAIE.RA...NPADYV --------70--------80--------90-------100-------110-------120-------130-------140-------150---- -------- LEHHHHHH
Dihedral angle restraints
--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160 RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIA ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .DSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINETKLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPK.. -------- LEHHHHHH ||| ||| .EHH.HHH