Solution NMR structure of Lin0431 protein from Listeria innocua. Northeast Structural Genomics Consortium Target LkR112
MKNTGDEVVA IISQNGKVIR EIPLTGHKGN EQFTIKGKGA QYNLMEVDGE RIRIKEDNSP DQVGVKMGWK SKAGDTIVCL PHKVFVEIKS TQKDSKDPDT DLIVPNLEHH HHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.9 % (1238 of 1332) | 92.8 % (649 of 699) | 92.8 % (475 of 512) | 94.2 % (114 of 121) |
Backbone | 93.3 % (629 of 674) | 93.1 % (217 of 233) | 93.4 % (310 of 332) | 93.6 % (102 of 109) |
Sidechain | 92.9 % (708 of 762) | 92.7 % (432 of 466) | 93.0 % (264 of 284) | 100.0 % (12 of 12) |
Aromatic | 66.7 % (48 of 72) | 66.7 % (24 of 36) | 65.7 % (23 of 35) | 100.0 % (1 of 1) |
Methyl | 99.2 % (117 of 118) | 98.3 % (58 of 59) | 100.0 % (59 of 59) |
1. LkR112
MKNTGDEVVA IISQNGKVIR EIPLTGHKGN EQFTIKGKGA QYNLMEVDGE RIRIKEDNSP DQVGVKMGWK SKAGDTIVCL PHKVFVEIKS TQKDSKDPDT DLIVPNLEHH HHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | LkR112 | [U-5% 13C; U-100% 15N] | 0.887 mM | |
11 | MES | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 200 mM | |
13 | CaCl2 | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | NaN3 | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | LkR112 | [U-5% 13C; U-100% 15N] | 0.887 mM | |
11 | MES | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 200 mM | |
13 | CaCl2 | natural abundance | 5 mM | |
14 | DTT | natural abundance | 10 mM | |
15 | NaN3 | natural abundance | 0.02 % | |
16 | DSS | natural abundance | 50 uM | |
17 | H2O | natural abundance | 95 % | |
18 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz cryoprobe
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | LkR112 | [U-100% 13C; U-100% 15N] | 0.851 mM | |
2 | MES | natural abundance | 20 mM | |
3 | NaCl | natural abundance | 200 mM | |
4 | CaCl2 | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | NaN3 | natural abundance | 0.02 % | |
7 | DSS | natural abundance | 50 uM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16563_2kpp.nef |
Input source #2: Coordindates | 2kpp.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKNTGDEVVAIISQNGKVIREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWKSKAGDTIVCLPHKVFVEIKSTQKDSKDPDT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKNTGDEVVAIISQNGKVIREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWKSKAGDTIVCLPHKVFVEIKSTQKDSKDPDT -------110---- DLIVPNLEHHHHHH |||||||||||||| DLIVPNLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 114 | 0 | 0 | 100.0 |
Content subtype: combined_16563_2kpp.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKNTGDEVVAIISQNGKVIREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWKSKAGDTIVCLPHKVFVEIKSTQKDSKDPDT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .KNTGDEVVAIISQNGKVIREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWKSKAGDTIVCLPHKVFVEIKSTQKDSKDPDT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110---- DLIVPNLEHHHHHH |||||||||| DLIVPNLEHH -------110
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 699 | 661 | 94.6 |
13C chemical shifts | 512 | 474 | 92.6 |
15N chemical shifts | 124 | 117 | 94.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 233 | 221 | 94.8 |
13C chemical shifts | 228 | 210 | 92.1 |
15N chemical shifts | 109 | 102 | 93.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 466 | 440 | 94.4 |
13C chemical shifts | 284 | 264 | 93.0 |
15N chemical shifts | 15 | 15 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 62 | 60 | 96.8 |
13C chemical shifts | 62 | 60 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 36 | 24 | 66.7 |
13C chemical shifts | 35 | 23 | 65.7 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKNTGDEVVAIISQNGKVIREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWKSKAGDTIVCLPHKVFVEIKSTQKDSKDPDT ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .KNTGDEVVAIISQNGKVIREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWKSKAGDTIVCLPHKVFVEIKSTQKDSKDPDT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110---- DLIVPNLEHHHHHH |||||||| DLIVPNLE --------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MKNTGDEVVAIISQNGKVIREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWKSKAGDTIVCLPHKVFVEIKSTQKDSKDPDT ||||||||||||||||| ||||||||| |||||||| ||||||| ||||||| |||||| ||||||||| ......EVVAIISQNGKVIREIP.....GNEQFTIKG....YNLMEVDG.RIRIKED....QVGVKMG......DTIVCL..KVFVEIKST --------10--------20--------30--------40--------50--------60--------70--------80--------90- -------110---- DLIVPNLEHHHHHH