BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	91.5 % (806 of 881)	90.8 % (422 of 465)	92.1 % (314 of 341)	93.3 % (70 of 75)
Backbone	97.2 % (420 of 432)	96.6 % (140 of 145)	97.7 % (212 of 217)	97.1 % (68 of 70)
Sidechain	87.9 % (457 of 520)	88.1 % (282 of 320)	88.7 % (173 of 195)	40.0 % (2 of 5)
Aromatic	82.9 % (68 of 82)	97.6 % (40 of 41)	66.7 % (26 of 39)	100.0 % (2 of 2)
Methyl	98.4 % (61 of 62)	96.8 % (30 of 31)	100.0 % (31 of 31)

1. J-domain of CbpA

GSELKDYYAI MGVKPTDDLK TIKTAYRRLA RKYHPDVSKE PDAEARFKEV AEAWEVLSDE QRRAEYDQMW QHR

Show sample condition

Sample

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 6.8

#	Name	Isotope labeling	Concentration
1	J-domain of CbpA	[U-13C; U-15N]	1 mM
2	sodium phosphate	natural abundance	50 mM
3	sodium chloride	natural abundance	250 mM
4	DTT	natural abundance	1 mM

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.05 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.05 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.08 ppm, Outliers: 1 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 3.54 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 10 models in PDB: 2KQX, Strand ID: A Detail

Release date

2010-05-04

Citation

Structural basis of the regulation of the CbpA co-chaperone by its specific modulator CbpM
Sarraf, N.S., Baardsnes, J., Cheng, J., Cygler, M., Ekiel, M.
J. Mol. Biol. (2010), 398, 111-121, PubMed 20226195 , DOI 10.1016/j.jmb.2010.03.006 , Abstract

Related entities 1. J-domain of CbpA, : 1 : 1 : 14 : 275 entities Detail

Interaction partners 1. J-domain of CbpA, : 10 interactors Detail

More details for 10 interactors identified by 5 citations

Experiments performed 4 experiments Detail

Chemical shift validation 3 contents Detail

Properties

Input source #1: Assigned chemical shifts - Assigned chemical shifts	bmr16618_3.str
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Content subtype: bmr16618_3.str

#	Content subtype	Saveframe	Status	# of rows	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	885		98.6 (chain: 1, length: 73)
1	Chemical shift references	chemical_shift_reference_1	OK	3		No information

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1

Status: Warning

Sequence coverage of experimental data

Entity_assembly_ID: 1, Chain length: 73, Sequence coverage: 98.6%

--------10--------20--------30--------40--------50--------60--------70---
GSELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYDQMWQHR
 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
.SELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYDQMWQHR

Total number of assignments
- ¹H chemical shifts: 484
- ¹³C chemical shifts: 331
- ¹⁵N chemical shifts: 70

Completeness of assignments

Entity_assemble_ID: 1

Excluded Atom_ID in statistics

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
6	ASP	CG	178.0
7	TYR	CG	130.0
8	TYR	CG	130.0
17	ASP	CG	178.0
18	ASP	CG	178.0
26	TYR	CG	130.0
33	TYR	CG	130.0
34	HIS	CG	130.0
36	ASP	CG	178.0
42	ASP	CG	178.0
47	PHE	CG	138.0
54	TRP	CE2	130.0
54	TRP	CG	110.0
59	ASP	CG	178.0
66	TYR	CG	130.0
67	ASP	CG	178.0
70	TRP	CG	110.0
72	HIS	CG	130.0

All atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	465	420	90.3
¹³C chemical shifts	341	313	91.8
¹⁵N chemical shifts	82	70	85.4

Backbone atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	145	140	96.6
¹³C chemical shifts	146	141	96.6
¹⁵N chemical shifts	70	68	97.1

Side chain atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	320	280	87.5
¹³C chemical shifts	195	172	88.2
¹⁵N chemical shifts	12	2	16.7

Methyl group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	33	32	97.0
¹³C chemical shifts	33	33	100.0

Aromatic group atoms

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	41	40	97.6
¹³C chemical shifts	39	26	66.7
¹⁵N chemical shifts	2	2	100.0

Peptide bond of PRO
Tautomeric state of HIS
Rotameric state of ILE , LEU, and VAL
Histogram of normalized assigned chemical shifts
Random coil index and derived parameters (S² and NMR RMSD)
- Chain_ID: 1

Keywords CbpA-J domain, NMR strucure

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.747 seconds)

BMRB: 16618

Sample

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. J-domain of CbpA, : 1 : 1 : 14 : 275 entities Detail

Interaction partners 1. J-domain of CbpA, : 10 interactors Detail

Experiments performed 4 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Chemical shift validation 3 contents Detail