Solution NMR structure of SH3 domain from CPF_0587 (fragment 415-479) from Clostridium perfringens. Northeast Structural Genomics Consortium (NESG) Target CpR74A.
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 92.5 % (788 of 852) | 92.3 % (407 of 441) | 92.4 % (304 of 329) | 93.9 % (77 of 82) |
Backbone | 93.4 % (413 of 442) | 93.6 % (146 of 156) | 93.4 % (199 of 213) | 93.2 % (68 of 73) |
Sidechain | 91.8 % (436 of 475) | 91.6 % (261 of 285) | 91.7 % (166 of 181) | 100.0 % (9 of 9) |
Aromatic | 71.8 % (56 of 78) | 71.8 % (28 of 39) | 71.1 % (27 of 38) | 100.0 % (1 of 1) |
Methyl | 100.0 % (76 of 76) | 100.0 % (38 of 38) | 100.0 % (38 of 38) |
1. CPF 0587-SH3
MQGVVKVNSA LNMRSGPGSN YGVIGTLRNN DKVEIIKEVD GWYEIRFNGK VGYASKSYIT IVNEGSLEHH HHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MES | natural abundance | 20 (±1.0) mM | |
8 | sodium chloride | natural abundance | 100 (±10.0) mM | |
9 | calcium chloride | natural abundance | 5 (±0.25) mM | |
10 | DTT | natural abundance | 10 (±0.5) mM | |
11 | sodium azide | natural abundance | 0.02 (±0.001) % | |
12 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1), Details 100% 15N and 5% 13C labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | MES | natural abundance | 20 (±1.0) mM | |
14 | sodium chloride | natural abundance | 100 (±10.0) mM | |
15 | calcium chloride | natural abundance | 5 (±0.25) mM | |
16 | DTT | natural abundance | 10 (±0.5) mM | |
17 | sodium azide | natural abundance | 0.02 (±0.001) % | |
18 | protein | [U-5% 13C; U-100% 15N] | 0.9 (±0.05) mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MES | natural abundance | 20 (±1.0) mM | |
8 | sodium chloride | natural abundance | 100 (±10.0) mM | |
9 | calcium chloride | natural abundance | 5 (±0.25) mM | |
10 | DTT | natural abundance | 10 (±0.5) mM | |
11 | sodium azide | natural abundance | 0.02 (±0.001) % | |
12 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MES | natural abundance | 20 (±1.0) mM | |
8 | sodium chloride | natural abundance | 100 (±10.0) mM | |
9 | calcium chloride | natural abundance | 5 (±0.25) mM | |
10 | DTT | natural abundance | 10 (±0.5) mM | |
11 | sodium azide | natural abundance | 0.02 (±0.001) % | |
12 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 10 (±0.5) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | MES | natural abundance | 20 (±1.0) mM | |
8 | sodium chloride | natural abundance | 100 (±10.0) mM | |
9 | calcium chloride | natural abundance | 5 (±0.25) mM | |
10 | DTT | natural abundance | 10 (±0.5) mM | |
11 | sodium azide | natural abundance | 0.02 (±0.001) % | |
12 | protein | [U-100% 13C; U-100% 15N] | 0.8 (±0.05) mM |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 (±.5) K, pH 6.5 (±.1), Details 100% 15N and 5% 13C labeled
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | MES | natural abundance | 20 (±1.0) mM | |
14 | sodium chloride | natural abundance | 100 (±10.0) mM | |
15 | calcium chloride | natural abundance | 5 (±0.25) mM | |
16 | DTT | natural abundance | 10 (±0.5) mM | |
17 | sodium azide | natural abundance | 0.02 (±0.001) % | |
18 | protein | [U-5% 13C; U-100% 15N] | 0.9 (±0.05) mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16647_2krs.nef |
Input source #2: Coordindates | 2krs.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70---- MQGVVKVNSALNMRSGPGSNYGVIGTLRNNDKVEIIKEVDGWYEIRFNGKVGYASKSYITIVNEGSLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQGVVKVNSALNMRSGPGSNYGVIGTLRNNDKVEIIKEVDGWYEIRFNGKVGYASKSYITIVNEGSLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 74 | 0 | 0 | 100.0 |
Content subtype: combined_16647_2krs.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70---- MQGVVKVNSALNMRSGPGSNYGVIGTLRNNDKVEIIKEVDGWYEIRFNGKVGYASKSYITIVNEGSLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MQGVVKVNSALNMRSGPGSNYGVIGTLRNNDKVEIIKEVDGWYEIRFNGKVGYASKSYITIVNEGSLEHH --------10--------20--------30--------40--------50--------60--------70
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
8 | ASN | CG | 176.9 |
12 | ASN | CG | 174.9 |
20 | ASN | CG | 177.3 |
29 | ASN | CG | 175.9 |
30 | ASN | CG | 177.6 |
48 | ASN | CG | 177.2 |
63 | ASN | CG | 177.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 441 | 402 | 91.2 |
13C chemical shifts | 329 | 300 | 91.2 |
15N chemical shifts | 85 | 76 | 89.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 156 | 144 | 92.3 |
13C chemical shifts | 148 | 136 | 91.9 |
15N chemical shifts | 73 | 67 | 91.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 285 | 258 | 90.5 |
13C chemical shifts | 181 | 164 | 90.6 |
15N chemical shifts | 12 | 9 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 40 | 40 | 100.0 |
13C chemical shifts | 40 | 40 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 27 | 69.2 |
13C chemical shifts | 38 | 26 | 68.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70---- MQGVVKVNSALNMRSGPGSNYGVIGTLRNNDKVEIIKEVDGWYEIRFNGKVGYASKSYITIVNEGSLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || MQGVVKVNSALNMRSGPGSNYGVIGTLRNNDKVEIIKEVDGWYEIRFNGKVGYASKSYITIVNEG.LE --------10--------20--------30--------40--------50--------60--------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70---- MQGVVKVNSALNMRSGPGSNYGVIGTLRNNDKVEIIKEVDGWYEIRFNGKVGYASKSYITIVNEGSLEHHHHHH ||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| MQGVVKVNSALNMRSGPGSNYGVIGTLRN.DKVEIIKEVDGWYEIRFNGKVGYASKSYITIVN --------10--------20--------30--------40--------50--------60---