1H, 13C and 15N assignments of the dimeric regulatory subunit (ilvN) of E.coli AHAS I
GSMQNTTHDN VILELTVRNH PGVMTHVCGL FARRAFNVEG ILCLPIQDSD KSHIWLLVND DQRLEQMISQ IDKLEDVVKV QRNQSDPTMF NKIAVFFQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.7 % (1011 of 1166) | 86.8 % (526 of 606) | 86.2 % (387 of 449) | 88.3 % (98 of 111) |
Backbone | 93.0 % (541 of 582) | 93.4 % (184 of 197) | 92.1 % (267 of 290) | 94.7 % (90 of 95) |
Sidechain | 82.9 % (562 of 678) | 83.6 % (342 of 409) | 83.8 % (212 of 253) | 50.0 % (8 of 16) |
Aromatic | 64.1 % (50 of 78) | 69.2 % (27 of 39) | 57.9 % (22 of 38) | 100.0 % (1 of 1) |
Methyl | 96.7 % (116 of 120) | 96.7 % (58 of 60) | 96.7 % (58 of 60) |
1. ilvN
GSMQNTTHDN VILELTVRNH PGVMTHVCGL FARRAFNVEG ILCLPIQDSD KSHIWLLVND DQRLEQMISQ IDKLEDVVKV QRNQSDPTMF NKIAVFFQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ilvN | [U-99% 15N] | 0.4 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % | |
6 | L-Valine | natural abundance | 5 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ilvN | [U-99% 15N] | 0.4 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % | |
6 | L-Valine | natural abundance | 5 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ilvN | [U-99% 15N] | 0.4 mM | |
2 | potassium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 20 mM | |
4 | EDTA | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.01 % | |
6 | L-Valine | natural abundance | 5 mM | |
7 | H2O | natural abundance | 90 % | |
8 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | ilvN | [U-99% 13C; U-99% 15N] | 0.4 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 20 mM | |
12 | EDTA | natural abundance | 1 mM | |
13 | sodium azide | natural abundance | 0.01 % | |
14 | L-Valine | natural abundance | 5 mM | |
15 | H2O | natural abundance | 90 % | |
16 | D2O | natural abundance | 10 % |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr16687_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------- GSMQNTTHDNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQRLEQMISQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..MQNTTHDNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQRLEQMISQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 606 | 531 | 87.6 |
13C chemical shifts | 449 | 387 | 86.2 |
15N chemical shifts | 116 | 98 | 84.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 197 | 189 | 95.9 |
13C chemical shifts | 196 | 177 | 90.3 |
15N chemical shifts | 95 | 90 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 409 | 342 | 83.6 |
13C chemical shifts | 253 | 210 | 83.0 |
15N chemical shifts | 21 | 8 | 38.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 58 | 90.6 |
13C chemical shifts | 64 | 58 | 90.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 27 | 69.2 |
13C chemical shifts | 38 | 22 | 57.9 |
15N chemical shifts | 1 | 1 | 100.0 |