Solution NMR Structure of Probable 30S Ribosomal Protein PSRP-3 (Ycf65-like protein) from Synechocystis sp. (strain PCC 6803), Northeast Structural Genomics Consortium Target Target SgR46
MAASTVHTSF ILKVLWLDQN VAIAVDQIVG KGTSPLTSYF FWPRADAWQQ LKDELEAKHW IAEADRINVL NQATEVINFW QDLKNQNKQI SMAEAQGKFP EVVFSGSNLE HHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.8 % (1166 of 1391) | 90.8 % (650 of 716) | 73.2 % (396 of 541) | 89.6 % (120 of 134) |
Backbone | 77.7 % (536 of 690) | 89.7 % (209 of 233) | 66.3 % (228 of 344) | 87.6 % (99 of 113) |
Sidechain | 90.2 % (733 of 813) | 91.3 % (441 of 483) | 87.7 % (271 of 309) | 100.0 % (21 of 21) |
Aromatic | 73.1 % (117 of 160) | 78.8 % (63 of 80) | 65.3 % (49 of 75) | 100.0 % (5 of 5) |
Methyl | 99.3 % (133 of 134) | 100.0 % (67 of 67) | 98.5 % (66 of 67) |
1. SgR46
MAASTVHTSF ILKVLWLDQN VAIAVDQIVG KGTSPLTSYF FWPRADAWQQ LKDELEAKHW IAEADRINVL NQATEVINFW QDLKNQNKQI SMAEAQGKFP EVVFSGSNLE HHHHHHSolvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 1.1 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SgR46 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 0.8 mM [10% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | SgR46 | [U-10% 13C; U-100% 15N] | 0.8 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 0.3 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | SgR46 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 1.1 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SgR46 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 1.1 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SgR46 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 4.5, Details 0.3 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | SgR46 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 4.5, Details 0.3 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | SgR46 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 4.5, Details 0.3 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | SgR46 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 1.1 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SgR46 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 1.1 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SgR46 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 0.8 mM [10% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | SgR46 | [U-10% 13C; U-100% 15N] | 0.8 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 4.5, Details 0.3 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | SgR46 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 1.1 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SgR46 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 1.1 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SgR46 | [U-100% 13C; U-100% 15N] | 1.1 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 4.5, Details 0.3 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | SgR46 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 4.5, Details 0.3 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | SgR46 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 4.5, Details 0.3 mM [U-100% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | SgR46 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
8 | H2O | natural abundance | 95 % | |
9 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 0.8 mM [10% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | SgR46 | [U-10% 13C; U-100% 15N] | 0.8 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 0.8 mM [10% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | SgR46 | [U-10% 13C; U-100% 15N] | 0.8 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 0.8 mM [10% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | SgR46 | [U-10% 13C; U-100% 15N] | 0.8 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 0.8 mM [10% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | SgR46 | [U-10% 13C; U-100% 15N] | 0.8 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 0.8 mM [10% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | SgR46 | [U-10% 13C; U-100% 15N] | 0.8 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 0.8 mM [10% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | SgR46 | [U-10% 13C; U-100% 15N] | 0.8 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 0.8 mM [10% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | SgR46 | [U-10% 13C; U-100% 15N] | 0.8 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 0.8 mM [10% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | SgR46 | [U-10% 13C; U-100% 15N] | 0.8 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 0.8 mM [10% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | SgR46 | [U-10% 13C; U-100% 15N] | 0.8 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1.0 atm, Temperature 293 K, pH 7.5, Details 0.8 mM [10% 13C; U-100% 15N] SR232, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | SgR46 | [U-10% 13C; U-100% 15N] | 0.8 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16691_2kt9.nef |
Input source #2: Coordindates | 2kt9.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQISMAEAQGKFP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQISMAEAQGKFP -------110------ EVVFSGSNLEHHHHHH |||||||||||||||| EVVFSGSNLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 116 | 0 | 0 | 100.0 |
Content subtype: combined_16691_2kt9.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQISMAEAQGKFP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| ..ASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQI.MAEAQGKFP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110------ EVVFSGSNLEHHHHHH ||||||||||| EVVFSGSNLEH -------110-
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
37 | THR | HG1 | 5.36 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 716 | 648 | 90.5 |
13C chemical shifts | 541 | 373 | 68.9 |
15N chemical shifts | 136 | 117 | 86.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 233 | 206 | 88.4 |
13C chemical shifts | 232 | 106 | 45.7 |
15N chemical shifts | 113 | 96 | 85.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 483 | 442 | 91.5 |
13C chemical shifts | 309 | 267 | 86.4 |
15N chemical shifts | 23 | 21 | 91.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 67 | 97.1 |
13C chemical shifts | 69 | 67 | 97.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 80 | 65 | 81.2 |
13C chemical shifts | 75 | 46 | 61.3 |
15N chemical shifts | 5 | 5 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQISMAEAQGKFP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| ....TVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQI.MAEAQGKFP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110------ EVVFSGSNLEHHHHHH |||||| |||| EVVFSG.NLEH -------110-
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQISMAEAQGKFP |||||||||||||||||||||||| ||||||||||| ||||||||||||||||||||||||||||||||||||||||||| |||||||| ......HTSFILKVLWLDQNVAIAVDQIVG.GTSPLTSYFFW...DAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNK...MAEAQGKF. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110------ EVVFSGSNLEHHHHHH ||||||| EVVFSGS -------