Solution NMR Structure of the N-terminal domain of protein PG_0361 from P.gingivalis, Northeast Structural Genomics Consortium Target Target PgR37A
MRVYKPEDVP NVQLADSTRL VTDEAGLLSN AQEEVMNGRL RAIRSSHAVE FAVVTLPSIG DAPLEDFTLK LARQWGVGNE KNNNGLLLVL VLDQRRVRFE TGYGLEGYLP DGLLSRIIHD RMIPHFRSGN YAEGLSEGVL AVQQVLDGSL EHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.3 % (1711 of 1796) | 95.2 % (884 of 929) | 95.6 % (670 of 701) | 94.6 % (157 of 166) |
Backbone | 95.5 % (888 of 930) | 95.7 % (308 of 322) | 95.8 % (438 of 457) | 94.0 % (142 of 151) |
Sidechain | 95.3 % (962 of 1009) | 94.9 % (576 of 607) | 95.9 % (371 of 387) | 100.0 % (15 of 15) |
Aromatic | 80.8 % (97 of 120) | 81.7 % (49 of 60) | 79.7 % (47 of 59) | 100.0 % (1 of 1) |
Methyl | 99.0 % (196 of 198) | 98.0 % (97 of 99) | 100.0 % (99 of 99) |
1. PgR37A
MRVYKPEDVP NVQLADSTRL VTDEAGLLSN AQEEVMNGRL RAIRSSHAVE FAVVTLPSIG DAPLEDFTLK LARQWGVGNE KNNNGLLLVL VLDQRRVRFE TGYGLEGYLP DGLLSRIIHD RMIPHFRSGN YAEGLSEGVL AVQQVLDGSL EHHHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-5% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | PgR37A | [U-5% 13C; U-100% 15N] | 0.8 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | calcium chloride | natural abundance | 5 mM | |
13 | sodium azide | natural abundance | 0.02 % | |
14 | DSS | natural abundance | 50 uM | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-5% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | PgR37A | [U-5% 13C; U-100% 15N] | 0.8 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | calcium chloride | natural abundance | 5 mM | |
13 | sodium azide | natural abundance | 0.02 % | |
14 | DSS | natural abundance | 50 uM | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.8 mM [U-100% 13C; U-100% 15N] PgR37A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PgR37A | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | sodium azide | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_16810_2kw7.nef |
Input source #2: Coordindates | 2kw7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFE -------110-------120-------130-------140-------150------- TGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| TGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 157 | 0 | 0 | 100.0 |
Content subtype: combined_16810_2kw7.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150------- TGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||| TGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLEH -------110-------120-------130-------140-------150--
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
22 | THR | HG1 | 7.125 |
29 | SER | HG | 5.941 |
47 | HIS | ND1 | 224.341 |
47 | HIS | NE2 | 170.13 |
55 | THR | HG1 | 6.714 |
68 | THR | HG1 | 6.007 |
119 | HIS | ND1 | 192.453 |
119 | HIS | NE2 | 186.903 |
125 | HIS | ND1 | 238.085 |
125 | HIS | NE2 | 168.216 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 929 | 893 | 96.1 |
13C chemical shifts | 701 | 667 | 95.1 |
15N chemical shifts | 178 | 163 | 91.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 322 | 310 | 96.3 |
13C chemical shifts | 314 | 297 | 94.6 |
15N chemical shifts | 151 | 139 | 92.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 607 | 583 | 96.0 |
13C chemical shifts | 387 | 370 | 95.6 |
15N chemical shifts | 27 | 24 | 88.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 102 | 102 | 100.0 |
13C chemical shifts | 102 | 102 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 48 | 80.0 |
13C chemical shifts | 59 | 47 | 79.7 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150------- TGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||| TGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLEH -------110-------120-------130-------140-------150--
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150------- TGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||| TGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLEH -------110-------120-------130-------140-------150--
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFE ||||| ||||||||||||||||| ||||||||| ||||||||||| ||||||||| |||||| ...................LVTDE....SNAQEEVMNGRLRAIRS...VEFAVVTLP........DFTLKLARQWG.......NGLLLVLVL..RRVRFE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150------- TGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLEHHHHHH | ||||| ||||||||||| |||||| ||||||||||||||||||| T.YGLEG..PDGLLSRIIHD.MIPHFR..NYAEGLSEGVLAVQQVLDG -------110-------120-------130-------140--------
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFE ||||| ||||||||||||||||| ||||||||| ||||||||||| ||||||||| |||||| ...................LVTDE....SNAQEEVMNGRLRAIRS...VEFAVVTLP........DFTLKLARQWG.......NGLLLVLVL..RRVRFE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150------- TGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLEHHHHHH | ||||| ||||||||||| |||||| ||||||||||||||||||| T.YGLEG..PDGLLSRIIHD.MIPHFR..NYAEGLSEGVLAVQQVLDG -------110-------120-------130-------140--------