the N-terminal domain of human H-REV107
MRAPIPEPKP GDLIEIFRPF YRHWAIYVGD GYVVHLAPPS EVAGAGAASV MSALTDKAIV KKELLYDVAG SDKYQVNNKH DDKYSPLPCS KIIQRAEELV GQEVLYKLTS ENCEHFVNEL RYGVA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.9 % (1295 of 1456) | 86.6 % (655 of 756) | 90.6 % (522 of 576) | 95.2 % (118 of 124) |
Backbone | 94.1 % (689 of 732) | 94.0 % (234 of 249) | 94.0 % (345 of 367) | 94.8 % (110 of 116) |
Sidechain | 85.6 % (720 of 841) | 83.0 % (421 of 507) | 89.3 % (291 of 326) | 100.0 % (8 of 8) |
Aromatic | 55.7 % (68 of 122) | 55.7 % (34 of 61) | 55.0 % (33 of 60) | 100.0 % (1 of 1) |
Methyl | 95.8 % (138 of 144) | 94.4 % (68 of 72) | 97.2 % (70 of 72) |
1. H-REV107N
MRAPIPEPKP GDLIEIFRPF YRHWAIYVGD GYVVHLAPPS EVAGAGAASV MSALTDKAIV KKELLYDVAG SDKYQVNNKH DDKYSPLPCS KIIQRAEELV GQEVLYKLTS ENCEHFVNEL RYGVASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H-REV107N | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.05 w/v | |
8 | DSS | natural abundance | 0.02 w/v |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz Cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H-REV107N | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.05 w/v | |
8 | DSS | natural abundance | 0.02 w/v |
Bruker Avance - 500 MHz Cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H-REV107N | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.05 w/v | |
8 | DSS | natural abundance | 0.02 w/v |
Bruker Avance - 500 MHz Cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H-REV107N | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.05 w/v | |
8 | DSS | natural abundance | 0.02 w/v |
Bruker Avance - 500 MHz Cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H-REV107N | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.05 w/v | |
8 | DSS | natural abundance | 0.02 w/v |
Bruker Avance - 500 MHz Cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H-REV107N | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.05 w/v | |
8 | DSS | natural abundance | 0.02 w/v |
Bruker Avance - 500 MHz Cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H-REV107N | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.05 w/v | |
8 | DSS | natural abundance | 0.02 w/v |
Bruker Avance - 500 MHz Cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H-REV107N | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.05 w/v | |
8 | DSS | natural abundance | 0.02 w/v |
Bruker Avance - 500 MHz Cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H-REV107N | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.05 w/v | |
8 | DSS | natural abundance | 0.02 w/v |
Bruker Avance - 500 MHz Cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | H-REV107N | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | sodium chloride | natural abundance | 30 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % | |
7 | sodium azide | natural abundance | 0.05 w/v | |
8 | DSS | natural abundance | 0.02 w/v |
Properties
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneContent subtype: bmr16883_3.str
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELV |||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||| |||||||||||| MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAG.ASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPL.CSKIIQRAEELV -------110-------120----- GQEVLYKLTSENCEHFVNELRYGVA ||||||||||||||||||||||||| GQEVLYKLTSENCEHFVNELRYGVA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 756 | 658 | 87.0 |
13C chemical shifts | 576 | 518 | 89.9 |
15N chemical shifts | 129 | 116 | 89.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 249 | 234 | 94.0 |
13C chemical shifts | 250 | 227 | 90.8 |
15N chemical shifts | 116 | 108 | 93.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 507 | 424 | 83.6 |
13C chemical shifts | 326 | 291 | 89.3 |
15N chemical shifts | 13 | 8 | 61.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 74 | 71 | 95.9 |
13C chemical shifts | 74 | 71 | 95.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 61 | 34 | 55.7 |
13C chemical shifts | 60 | 33 | 55.0 |
15N chemical shifts | 1 | 1 | 100.0 |