Solution NMR Structure of the N-terminal Domain of Putative ATP-dependent DNA Helicase RecG-related Protein from Nitrosomonas europaea, Northeast Structural Genomics Consortium Target NeR70A
MRSATDLLDE LNAVDESARI EAKRASDMGK SVMETVIAFA NEPGLDGGYL LLGVDWAIND KGDTVYRPVG LPDPDKVQRD LASQCASMLN VALRPEMQLE QVGGKTLLVV YVPEADVTHK PIYKKATGLP GGAYRRIGSS DQRCVLEHHH HHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.4 % (1630 of 1709) | 94.7 % (838 of 885) | 96.0 % (642 of 669) | 96.8 % (150 of 155) |
Backbone | 96.1 % (867 of 902) | 95.5 % (297 of 311) | 96.4 % (430 of 446) | 96.6 % (140 of 145) |
Sidechain | 94.8 % (898 of 947) | 94.3 % (541 of 574) | 95.6 % (347 of 363) | 100.0 % (10 of 10) |
Aromatic | 81.1 % (73 of 90) | 80.0 % (36 of 45) | 81.8 % (36 of 44) | 100.0 % (1 of 1) |
Methyl | 100.0 % (180 of 180) | 100.0 % (90 of 90) | 100.0 % (90 of 90) |
1. NeR70A
MRSATDLLDE LNAVDESARI EAKRASDMGK SVMETVIAFA NEPGLDGGYL LLGVDWAIND KGDTVYRPVG LPDPDKVQRD LASQCASMLN VALRPEMQLE QVGGKTLLVV YVPEADVTHK PIYKKATGLP GGAYRRIGSS DQRCVLEHHH HHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-5% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | NeR70A | [U-5% 13C; U-100% 15N] | 0.9 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | calcium chloride | natural abundance | 5 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | natural abundance | 5 % |
Solvent system 88% H2O/12% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.6 mM [U-5% 13C; U-100% 15N] NeR70A aligned in Pf1 phage, 88% H2O/12% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | NeR70A | [U-5% 13C; U-100% 15N] | 0.6 mM | |
18 | MES | natural abundance | 13 mM | |
19 | sodium chloride | natural abundance | 66 mM | |
20 | calcium chloride | natural abundance | 3.3 mM | |
21 | DTT | natural abundance | 6.6 mM | |
22 | sodium azide | natural abundance | 0.013 % | |
23 | Pf1 phage | natural abundance | 13.5 mg/mL | |
24 | H2O | natural abundance | 88 % | |
25 | D2O | natural abundance | 12 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Pressure 1 atm, Temperature 298 K, pH 6.5
Experiment name 2D 1H-15N J-modulated HSQC
List #1 RDC_list_1, RDC code DHN, Field strength (1H) 599.7664 MHz
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-5% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | NeR70A | [U-5% 13C; U-100% 15N] | 0.9 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | calcium chloride | natural abundance | 5 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-100% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | NeR70A | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DTT | natural abundance | 10 mM | |
6 | sodium azide | natural abundance | 0.02 % | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.9 mM [U-5% 13C; U-100% 15N] NeR70A, 95% H2O/5% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | NeR70A | [U-5% 13C; U-100% 15N] | 0.9 mM | |
10 | MES | natural abundance | 20 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | calcium chloride | natural abundance | 5 mM | |
13 | DTT | natural abundance | 10 mM | |
14 | sodium azide | natural abundance | 0.02 % | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 88% H2O/12% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.6 mM [U-5% 13C; U-100% 15N] NeR70A aligned in Pf1 phage, 88% H2O/12% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | NeR70A | [U-5% 13C; U-100% 15N] | 0.6 mM | |
18 | MES | natural abundance | 13 mM | |
19 | sodium chloride | natural abundance | 66 mM | |
20 | calcium chloride | natural abundance | 3.3 mM | |
21 | DTT | natural abundance | 6.6 mM | |
22 | sodium azide | natural abundance | 0.013 % | |
23 | Pf1 phage | natural abundance | 13.5 mg/mL | |
24 | H2O | natural abundance | 88 % | |
25 | D2O | natural abundance | 12 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_16991_2kyy.nef |
Input source #2: Coordindates | 2kyy.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRSATDLLDELNAVDESARIEAKRASDMGKSVMETVIAFANEPGLDGGYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRSATDLLDELNAVDESARIEAKRASDMGKSVMETVIAFANEPGLDGGYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLE -------110-------120-------130-------140-------150--- QVGGKTLLVVYVPEADVTHKPIYKKATGLPGGAYRRIGSSDQRCVLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||| QVGGKTLLVVYVPEADVTHKPIYKKATGLPGGAYRRIGSSDQRCVLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 153 | 0 | 0 | 100.0 |
Content subtype: combined_16991_2kyy.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRSATDLLDELNAVDESARIEAKRASDMGKSVMETVIAFANEPGLDGGYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRSATDLLDELNAVDESARIEAKRASDMGKSVMETVIAFANEPGLDGGYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150--- QVGGKTLLVVYVPEADVTHKPIYKKATGLPGGAYRRIGSSDQRCVLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||| QVGGKTLLVVYVPEADVTHKPIYKKATGLPGGAYRRIGSSDQRCVLEH -------110-------120-------130-------140--------
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
31 | SER | HG | 4.85 |
119 | HIS | ND1 | 219.455 |
119 | HIS | NE2 | 174.552 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 885 | 841 | 95.0 |
13C chemical shifts | 669 | 642 | 96.0 |
15N chemical shifts | 164 | 151 | 92.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 311 | 298 | 95.8 |
13C chemical shifts | 306 | 296 | 96.7 |
15N chemical shifts | 145 | 139 | 95.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 574 | 543 | 94.6 |
13C chemical shifts | 363 | 346 | 95.3 |
15N chemical shifts | 19 | 12 | 63.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 95 | 95 | 100.0 |
13C chemical shifts | 95 | 95 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 45 | 33 | 73.3 |
13C chemical shifts | 44 | 32 | 72.7 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRSATDLLDELNAVDESARIEAKRASDMGKSVMETVIAFANEPGLDGGYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLE |||||||||||||||||||||||||||| ||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||| MRSATDLLDELNAVDESARIEAKRASDM.KSVMETVIAFANEPGLD.GYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150--- QVGGKTLLVVYVPEADVTHKPIYKKATGLPGGAYRRIGSSDQRCVLEHHHHHH ||||||||||||||||||||||||||| || |||||| || ||||| QVGGKTLLVVYVPEADVTHKPIYKKAT.LP..AYRRIG.SD.RCVLE -------110-------120-------130-------140-------
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRSATDLLDELNAVDESARIEAKRASDMGKSVMETVIAFANEPGLDGGYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLE |||||||||||||||||||||||||||| ||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||| MRSATDLLDELNAVDESARIEAKRASDM.KSVMETVIAFANEPGLD.GYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150--- QVGGKTLLVVYVPEADVTHKPIYKKATGLPGGAYRRIGSSDQRCVLEHHHHHH ||||||||||||||||||||||||||| || |||||| || ||||| QVGGKTLLVVYVPEADVTHKPIYKKAT.LP..AYRRIG.SD.RCVLE -------110-------120-------130-------140-------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRSATDLLDELNAVDESARIEAKRASDMGKSVMETVIAFANEPGLDGGYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRSATDLLDELNAVDESARIEAKRASDMGKSVMETVIAFANEPGLDGGYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150--- QVGGKTLLVVYVPEADVTHKPIYKKATGLPGGAYRRIGSSDQRCVLEHHHHHH ||||||||||||||||||||||||| QVGGKTLLVVYVPEADVTHKPIYKK -------110-------120-----
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRSATDLLDELNAVDESARIEAKRASDMGKSVMETVIAFANEPGLDGGYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MRSATDLLDELNAVDESARIEAKRASDMGKSVMETVIAFANEPGLDGGYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150--- QVGGKTLLVVYVPEADVTHKPIYKKATGLPGGAYRRIGSSDQRCVLEHHHHHH ||||||||||||||||||||||||| QVGGKTLLVVYVPEADVTHKPIYKK -------110-------120-----
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MRSATDLLDELNAVDESARIEAKRASDMGKSVMETVIAFANEPGLDGGYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLE |||||||||||| ||| || |||||| || ||| ||| ||| |||| ||| ||| | |||||| |||| || | | ||| .RSATDLLDELNA.DES..IE.KRASDM...VM...IAF....GLD.GYL.LGVD.........VYR.VGL.D.DKVQRD...QCAS.LN..L..E.QLE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150--- QVGGKTLLVVYVPEADVTHKPIYKKATGLPGGAYRRIGSSDQRCVLEHHHHHH |||||||||||| ||||||| QVGGKTLLVVYV.EADVTHK -------110-------120