Solution NMR structure of the PBS linker polypeptide domain of phycobilisome linker protein apcE from Synechocystis sp. Northeast Structural Genomics Consortium Target SgR209C
PQSYFNAAAK RQKYAMKPGL SALEKNAVIK AAYRQIFERD ITKAYSQSIS YLESQVRNGD ISMKEFVRRL AKSPLYRKQF FEPFINSRAL ELAFRHILGR GPSSREEVQK YFSIVSSGGL PALVDALVDS QEYADYFGEE TVPYLRGLEH HHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.0 % (1680 of 1867) | 89.9 % (879 of 978) | 89.3 % (651 of 729) | 93.8 % (150 of 160) |
Backbone | 92.1 % (844 of 916) | 92.3 % (287 of 311) | 91.2 % (417 of 457) | 94.6 % (140 of 148) |
Sidechain | 88.8 % (975 of 1098) | 88.8 % (592 of 667) | 89.0 % (373 of 419) | 83.3 % (10 of 12) |
Aromatic | 66.7 % (132 of 198) | 67.7 % (67 of 99) | 65.7 % (65 of 99) | |
Methyl | 98.0 % (147 of 150) | 97.3 % (73 of 75) | 98.7 % (74 of 75) |
1. SLR0335
PQSYFNAAAK RQKYAMKPGL SALEKNAVIK AAYRQIFERD ITKAYSQSIS YLESQVRNGD ISMKEFVRRL AKSPLYRKQF FEPFINSRAL ELAFRHILGR GPSSREEVQK YFSIVSSGGL PALVDALVDS QEYADYFGEE TVPYLRGLEH HHHHHSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 100 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 100 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | MES | natural abundance | 20 (±1.0) mM | |
18 | sodium chloride | natural abundance | 100 (±10.0) mM | |
19 | calcium chloride | natural abundance | 5 (±0.25) mM | |
20 | DTT | natural abundance | 100 (±1.0) mM | |
21 | sodium azide | natural abundance | 0.02 (±0.001) % | |
22 | protein | [U-5% 13C; U-100% 15N] | 1.2 (±0.05) mM | |
23 | H2O | natural abundance | 95 % | |
24 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 100 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 100 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 100 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 100 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 100 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | natural abundance | 5 % |
Varian INOVA - 500 MHz at PNNL
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 100 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 500 MHz at PNNL
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 100 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 500 MHz at PNNL
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 100 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 500 MHz at PNNL
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 100 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 100 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 100 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 100 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
17 | MES | natural abundance | 20 (±1.0) mM | |
18 | sodium chloride | natural abundance | 100 (±10.0) mM | |
19 | calcium chloride | natural abundance | 5 (±0.25) mM | |
20 | DTT | natural abundance | 100 (±1.0) mM | |
21 | sodium azide | natural abundance | 0.02 (±0.001) % | |
22 | protein | [U-5% 13C; U-100% 15N] | 1.2 (±0.05) mM | |
23 | H2O | natural abundance | 95 % | |
24 | D2O | natural abundance | 5 % |
Varian INOVA - 500 MHz at PNNL
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 100 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Bruker AvanceIII - 850 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 100 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | MES | natural abundance | 20 (±1.0) mM | |
10 | sodium chloride | natural abundance | 100 (±5.0) mM | |
11 | calcium chloride | natural abundance | 5 (±0.25) mM | |
12 | DTT | natural abundance | 100 (±1.0) mM | |
13 | sodium azide | natural abundance | 0.02 (±0.001) % | |
14 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
15 | H2O | natural abundance | 95 % | |
16 | D2O | natural abundance | 5 % |
Varian INOVA - 500 MHz at PNNL
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 100 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Varian INOVA - 500 MHz at PNNL
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 293 (±.5) K, pH 6.5 (±.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 20 (±1.0) mM | |
2 | sodium chloride | natural abundance | 100 (±10.0) mM | |
3 | calcium chloride | natural abundance | 5 (±0.25) mM | |
4 | DTT | natural abundance | 100 (±1.0) mM | |
5 | sodium azide | natural abundance | 0.02 (±0.001) % | |
6 | protein | [U-100% 13C; U-100% 15N] | 1.4 (±0.05) mM | |
7 | H2O | natural abundance | 95 % | |
8 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17031_2l06.nef |
Input source #2: Coordindates | 2l06.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 PQSYFNAAAKRQKYAMKPGLSALEKNAVIKAAYRQIFERDITKAYSQSISYLESQVRNGDISMKEFVRRLAKSPLYRKQFFEPFINSRALELAFRHILGR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| PQSYFNAAAKRQKYAMKPGLSALEKNAVIKAAYRQIFERDITKAYSQSISYLESQVRNGDISMKEFVRRLAKSPLYRKQFFEPFINSRALELAFRHILGR -------110-------120-------130-------140-------150----- GPSSREEVQKYFSIVSSGGLPALVDALVDSQEYADYFGEETVPYLRGLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPSSREEVQKYFSIVSSGGLPALVDALVDSQEYADYFGEETVPYLRGLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 155 | 0 | 0 | 100.0 |
Content subtype: combined_17031_2l06.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 PQSYFNAAAKRQKYAMKPGLSALEKNAVIKAAYRQIFERDITKAYSQSISYLESQVRNGDISMKEFVRRLAKSPLYRKQFFEPFINSRALELAFRHILGR || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....NA.AKRQKYAMKPGLSALEKNAVIKAAYRQIFERDITKAYSQSISYLESQVRNGDISMKEFVRRLAKSPLYRKQFFEPFINSRALELAFRHILGR --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150----- GPSSREEVQKYFSIVSSGGLPALVDALVDSQEYADYFGEETVPYLRGLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||| GPSSREEVQKYFSIVSSGGLPALVDALVDSQEYADYFGEETVPYLRGLEHH -------110-------120-------130-------140-------150-
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
6 | ASN | CG | 176.9 |
12 | GLN | CD | 180.1 |
26 | ASN | CG | 175.7 |
47 | GLN | CD | 180.3 |
55 | GLN | CD | 179.0 |
58 | ASN | CG | 176.9 |
73 | SER | HG | 6.24 |
79 | GLN | CD | 179.2 |
86 | ASN | CG | 175.3 |
109 | GLN | CD | 180.2 |
130 | SER | HG | 5.64 |
131 | GLN | CD | 180.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 978 | 875 | 89.5 |
13C chemical shifts | 729 | 640 | 87.8 |
15N chemical shifts | 172 | 156 | 90.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 311 | 286 | 92.0 |
13C chemical shifts | 310 | 273 | 88.1 |
15N chemical shifts | 148 | 136 | 91.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 667 | 589 | 88.3 |
13C chemical shifts | 419 | 367 | 87.6 |
15N chemical shifts | 24 | 20 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 77 | 75 | 97.4 |
13C chemical shifts | 77 | 76 | 98.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 99 | 63 | 63.6 |
13C chemical shifts | 99 | 61 | 61.6 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 PQSYFNAAAKRQKYAMKPGLSALEKNAVIKAAYRQIFERDITKAYSQSISYLESQVRNGDISMKEFVRRLAKSPLYRKQFFEPFINSRALELAFRHILGR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........KRQKYAMKPGLSALEKNAVIKAAYRQIFERDITKAYSQSISYLESQVRNGDISMKEFVRRLAKSPLYRKQFFEPFINSRALELAFRHILGR --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150----- GPSSREEVQKYFSIVSSGGLPALVDALVDSQEYADYFGEETVPYLRGLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||| GPSSREEVQKYFSIVSSGGLPALVDALVDSQEYADYFGEETVPYLRGLEH -------110-------120-------130-------140-------150
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 PQSYFNAAAKRQKYAMKPGLSALEKNAVIKAAYRQIFERDITKAYSQSISYLESQVRNGDISMKEFVRRLAKSPLYRKQFFEPFINSRALELAFRHILGR | | |||||||||||||||| | | |||||||||||| ||||||||||||| || | |||||||||| .............Y.M....SALEKNAVIKAAYRQI.....T..Y.QSISYLESQVRN...SMKEFVRRLAKSP..RK.......N.RALELAFRHI... --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150----- GPSSREEVQKYFSIVSSGGLPALVDALVDSQEYADYFGEETVPYLRGLEHHHHHH ||||||||||||||| |||||||||||| ||| | | ...SREEVQKYFSIVSSG..PALVDALVDSQE.ADY...E.V -------110-------120-------130-------140--
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 PQSYFNAAAKRQKYAMKPGLSALEKNAVIKAAYRQIFERDITKAYSQSISYLESQVRNGDISMKEFVRRLAKSPLYRKQFFEPFINSRALELAFRHILGR ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| ||||||||||||||| ............KYAMKPGLSALEKNAVIKAAYRQIFER.......QSISYLESQVRNGDISMKEFVRRLAKSPLYRKQ.....INSRALELAFRHILG. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150----- GPSSREEVQKYFSIVSSGGLPALVDALVDSQEYADYFGEETVPYLRGLEHHHHHH ||||||||||||||| |||||||||||||||||||||||| ...SREEVQKYFSIVSSG.LPALVDALVDSQEYADYFGEETVP -------110-------120-------130-------140---