Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine. Seattle Structure Genomics Center for Infectious Disease (SSGCID)
GPGSMTVVTT ESGLKYEDLT EGSGAEARAG QTVSVHYTGW LTDGQKFDSS KDRNDPFAFV LGGGMVIKGW DEGVQGMKVG GVRRLTIPPQ LGYGARGAGG VIPPNATLVF EVELLDV
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.0 % (1104 of 1269) | 93.9 % (611 of 651) | 75.6 % (377 of 499) | 97.5 % (116 of 119) |
Backbone | 82.2 % (567 of 690) | 96.4 % (240 of 249) | 66.1 % (218 of 330) | 98.2 % (109 of 111) |
Sidechain | 93.5 % (631 of 675) | 92.3 % (371 of 402) | 95.5 % (253 of 265) | 87.5 % (7 of 8) |
Aromatic | 95.7 % (88 of 92) | 97.8 % (45 of 46) | 95.5 % (42 of 44) | 50.0 % (1 of 2) |
Methyl | 98.5 % (130 of 132) | 98.5 % (65 of 66) | 98.5 % (65 of 66) |
1. FKBP
GPGSMTVVTT ESGLKYEDLT EGSGAEARAG QTVSVHYTGW LTDGQKFDSS KDRNDPFAFV LGGGMVIKGW DEGVQGMKVG GVRRLTIPPQ LGYGARGAGG VIPPNATLVF EVELLDVSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | KCl | natural abundance | 100 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | DTT | natural abundance | 1 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
8 | D2O | natural abundance | 100 % | |
9 | KCl | natural abundance | 100 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DTT | natural abundance | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 4.71 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 4.71 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 4.71 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | KCl | natural abundance | 100 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | KCl | natural abundance | 100 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | KCl | natural abundance | 100 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | KCl | natural abundance | 100 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | KCl | natural abundance | 100 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
8 | D2O | natural abundance | 100 % | |
9 | KCl | natural abundance | 100 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
8 | D2O | natural abundance | 100 % | |
9 | KCl | natural abundance | 100 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
8 | D2O | natural abundance | 100 % | |
9 | KCl | natural abundance | 100 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | KCl | natural abundance | 100 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
2 | H2O | natural abundance | 95 % | |
3 | D2O | natural abundance | 5 % | |
4 | KCl | natural abundance | 100 mM | |
5 | potassium phosphate | natural abundance | 20 mM | |
6 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
8 | D2O | natural abundance | 100 % | |
9 | KCl | natural abundance | 100 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DTT | natural abundance | 1 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | isomerase | [U-99% 13C; U-99% 15N] | 0.6 ~ 1.5 mM | |
8 | D2O | natural abundance | 100 % | |
9 | KCl | natural abundance | 100 mM | |
10 | potassium phosphate | natural abundance | 20 mM | |
11 | DTT | natural abundance | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17151_2l2s.nef |
Input source #2: Coordindates | 2l2s.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | L2S | 1-{[(4-methylphenyl)sulfanyl]acetyl}piperidine | Assigned chemical shifts |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGG -------110------- VIPPNATLVFEVELLDV ||||||||||||||||| VIPPNATLVFEVELLDV
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 117 | 0 | 0 | 100.0 |
Content subtype: combined_17151_2l2s.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..GSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGG -------110------- VIPPNATLVFEVELLDV ||||||||||||||||| VIPPNATLVFEVELLDV
- X | X
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 651 | 622 | 95.5 |
15N chemical shifts | 124 | 116 | 93.5 |
13C chemical shifts | 499 | 363 | 72.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 249 | 244 | 98.0 |
15N chemical shifts | 111 | 109 | 98.2 |
13C chemical shifts | 234 | 112 | 47.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 402 | 378 | 94.0 |
15N chemical shifts | 13 | 7 | 53.8 |
13C chemical shifts | 265 | 251 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 69 | 66 | 95.7 |
13C chemical shifts | 69 | 65 | 94.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 44 | 95.7 |
15N chemical shifts | 2 | 1 | 50.0 |
13C chemical shifts | 44 | 40 | 90.9 |
Comp_index_ID | Comp_ID |
---|---|
1 | L2S |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....MTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAG. -------110------- VIPPNATLVFEVELLDV ||||||||||||||||| VIPPNATLVFEVELLDV
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPGSMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGG ||||||||| |||||||| | | | |||||||| |||| ||||||||||| | ||| |||| ||| || ||| |||||| || | | ...SMTVVTTES.LKYEDLTE.S..E.R..QTVSVHYT.WLTD.QKFDSSKDRND.F.FVL...MVIK.WDE.VQ.MKV..VRRLTI..QL.Y..R.... -------110------- VIPPNATLVFEVELLDV || | ||||||||||| VI..N.TLVFEVELLDV