SOLUTION STRUCTURE OF APO S100A16
SDCYTELEKA VIVLVENFYK YVSKYSLVKN KISKSSFREM LQKELNHMLS DTGNRKAADK LIQNLDANHD GRISFDEYWT LIGGITGPIA KLIHEQEQQS SS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 77.1 % (940 of 1219) | 67.8 % (431 of 636) | 87.4 % (411 of 470) | 86.7 % (98 of 113) |
Backbone | 95.4 % (582 of 610) | 93.8 % (195 of 208) | 96.7 % (291 of 301) | 95.0 % (96 of 101) |
Sidechain | 63.3 % (447 of 706) | 54.2 % (232 of 428) | 80.5 % (214 of 266) | 8.3 % (1 of 12) |
Aromatic | 1.1 % (1 of 94) | 2.1 % (1 of 47) | 0.0 % (0 of 46) | 0.0 % (0 of 1) |
Methyl | 56.4 % (62 of 110) | 12.7 % (7 of 55) | 100.0 % (55 of 55) |
1. entity
SDCYTELEKA VIVLVENFYK YVSKYSLVKN KISKSSFREM LQKELNHMLS DTGNRKAADK LIQNLDANHD GRISFDEYWT LIGGITGPIA KLIHEQEQQS SSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | APOS100A16 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | KCl | natural abundance | 200 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | APOS100A16 | [U-100% 15N] | 0.6 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % | |
8 | KCl | natural abundance | 200 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methylene carbons | 69.4 ppm | external | direct | 1.0 |
1H | TMS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methylene carbons | 69.4 ppm | external | direct | 1.0 |
1H | TMS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methylene carbons | 69.4 ppm | external | direct | 1.0 |
1H | TMS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methylene carbons | 69.4 ppm | external | direct | 1.0 |
1H | TMS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | APOS100A16 | [U-100% 15N] | 0.6 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % | |
8 | KCl | natural abundance | 200 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | APOS100A16 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | KCl | natural abundance | 200 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | APOS100A16 | [U-100% 15N] | 0.6 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % | |
8 | KCl | natural abundance | 200 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | APOS100A16 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | KCl | natural abundance | 200 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | APOS100A16 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | KCl | natural abundance | 200 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | APOS100A16 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | KCl | natural abundance | 200 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | APOS100A16 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | KCl | natural abundance | 200 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | APOS100A16 | [U-100% 15N] | 0.6 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % | |
8 | KCl | natural abundance | 200 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | APOS100A16 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | KCl | natural abundance | 200 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | APOS100A16 | [U-100% 15N] | 0.6 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % | |
8 | KCl | natural abundance | 200 mM |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | APOS100A16 | [U-100% 13C; U-100% 15N] | 0.6 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | KCl | natural abundance | 200 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17261_2l50.nef |
Input source #2: Coordindates | 2l50.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -- SS || SS --
---110-------120-------130-------140-------150-------160-------170-------180-------190-------200---- SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -- SS || SS --
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 102 | 0 | 0 | 100.0 |
B | B | 102 | 0 | 0 | 100.0 |
Content subtype: combined_17261_2l50.nef
Assigned chemical shifts
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQS -- SS || SS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
6 | THR | HG1 | 6.12 |
87 | THR | HG1 | 2.74 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 636 | 430 | 67.6 |
13C chemical shifts | 470 | 412 | 87.7 |
15N chemical shifts | 116 | 98 | 84.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 208 | 200 | 96.2 |
13C chemical shifts | 204 | 197 | 96.6 |
15N chemical shifts | 101 | 97 | 96.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 428 | 230 | 53.7 |
13C chemical shifts | 266 | 215 | 80.8 |
15N chemical shifts | 15 | 1 | 6.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 57 | 5 | 8.8 |
13C chemical shifts | 57 | 57 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 1 | 2.1 |
13C chemical shifts | 46 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQS |||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDCYTELEKAVIVLVENFYKYVSKYSLVKN.ISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQS -- SS || SS
---110-------120-------130-------140-------150-------160-------170-------180-------190-------200---- SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQS |||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SDCYTELEKAVIVLVENFYKYVSKYSLVKN.ISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQS -- SS || SS
Dihedral angle restraints
-------10--------20--------30--------40--------50--------60--------70--------80--------90-------100- SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQS |||||||||||||||||| |||||||||||||| ||||||||||||||||| |||||||||||||||| |||||||||| ....TELEKAVIVLVENFYKYV........KISKSSFREMLQKE.......TGNRKAADKLIQNLDAN..GRISFDEYWTLIGGIT..IAKLIHEQEQ -------10--------20--------30--------40--------50--------60--------70--------80--------90--------- -- SS
---110-------120-------130-------140-------150-------160-------170-------180-------190-------200---- SDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQS |||||||||||||||||| |||||||||||||| ||||||||||||||||| |||||||||||||||| |||||||||| ....TELEKAVIVLVENFYKYV........KISKSSFREMLQKE.......TGNRKAADKLIQNLDAN..GRISFDEYWTLIGGIT..IAKLIHEQEQ ---110-------120-------130-------140-------150-------160-------170-------180-------190-------200-- -- SS