Backbone and sidechain assignments of intein from DNA polymerase II of Pyrococcus abyssi
CFPGDTRILV QIDGVPQKIT LRELYELFED ERYENMVYVR KKPKREIKVY SIDLETGKVV LTDIEDVIKA PATDHLIRFE LEDGRSFETT VDHPVLVYEN GRFIEKRAFE VKEGDKVLVS ELELVEQSSS SQDNPKNENL GSPEHDQLLE IKNIKYVRAN DDFVFSLNAK KYHNVIINEN IVTHQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.5 % (1889 of 2235) | 92.0 % (1075 of 1169) | 72.3 % (630 of 871) | 94.4 % (184 of 195) |
Backbone | 85.5 % (937 of 1096) | 97.8 % (362 of 370) | 72.8 % (399 of 548) | 98.9 % (176 of 178) |
Sidechain | 85.6 % (1127 of 1317) | 89.2 % (713 of 799) | 81.0 % (406 of 501) | 47.1 % (8 of 17) |
Aromatic | 28.2 % (44 of 156) | 56.4 % (44 of 78) | 0.0 % (0 of 78) | |
Methyl | 96.8 % (215 of 222) | 100.0 % (111 of 111) | 93.7 % (104 of 111) |
1. Pab PolII
CFPGDTRILV QIDGVPQKIT LRELYELFED ERYENMVYVR KKPKREIKVY SIDLETGKVV LTDIEDVIKA PATDHLIRFE LEDGRSFETT VDHPVLVYEN GRFIEKRAFE VKEGDKVLVS ELELVEQSSS SQDNPKNENL GSPEHDQLLE IKNIKYVRAN DDFVFSLNAK KYHNVIINEN IVTHQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | EDTA | natural abundance | 0.5 mM | |
3 | sodium azide | natural abundance | 0.05 mM | |
4 | Pab PolII | [U-98% 13C; U-98% 15N] | 2 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.05 mM | |
7 | EDTA | natural abundance | 0.5 mM | |
8 | Pab PolII | [U-13C; U-15N; U-2H] | 1.2 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 20 mM | |
10 | EDTA | natural abundance | 0.5 mM | |
11 | sodium azide | natural abundance | 0.05 mM | |
12 | Pab PolII | [U-98% 15N] | 2 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 20 mM | |
14 | EDTA | natural abundance | 0.5 mM | |
15 | sodium azide | natural abundance | 0.05 mM | |
16 | Pab PolII | [U-98% 13C; U-98% 15N] | 2 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
31P | DSS | methyl protons | 0.0 ppm | null | indirect | 0.4048086 |
Bruker ARX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | sodium phosphate | natural abundance | 20 mM | |
6 | sodium azide | natural abundance | 0.05 mM | |
7 | EDTA | natural abundance | 0.5 mM | |
8 | Pab PolII | [U-13C; U-15N; U-2H] | 1.2 mM |
Bruker ARX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | EDTA | natural abundance | 0.5 mM | |
3 | sodium azide | natural abundance | 0.05 mM | |
4 | Pab PolII | [U-98% 13C; U-98% 15N] | 2 mM |
Bruker ARX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | EDTA | natural abundance | 0.5 mM | |
3 | sodium azide | natural abundance | 0.05 mM | |
4 | Pab PolII | [U-98% 13C; U-98% 15N] | 2 mM |
Bruker ARX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | EDTA | natural abundance | 0.5 mM | |
3 | sodium azide | natural abundance | 0.05 mM | |
4 | Pab PolII | [U-98% 13C; U-98% 15N] | 2 mM |
Bruker ARX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | EDTA | natural abundance | 0.5 mM | |
3 | sodium azide | natural abundance | 0.05 mM | |
4 | Pab PolII | [U-98% 13C; U-98% 15N] | 2 mM |
Bruker ARX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | EDTA | natural abundance | 0.5 mM | |
3 | sodium azide | natural abundance | 0.05 mM | |
4 | Pab PolII | [U-98% 13C; U-98% 15N] | 2 mM |
Bruker ARX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | EDTA | natural abundance | 0.5 mM | |
3 | sodium azide | natural abundance | 0.05 mM | |
4 | Pab PolII | [U-98% 13C; U-98% 15N] | 2 mM |
Bruker ARX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 20 mM | |
2 | EDTA | natural abundance | 0.5 mM | |
3 | sodium azide | natural abundance | 0.05 mM | |
4 | Pab PolII | [U-98% 13C; U-98% 15N] | 2 mM |
Bruker ARX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 20 mM | |
10 | EDTA | natural abundance | 0.5 mM | |
11 | sodium azide | natural abundance | 0.05 mM | |
12 | Pab PolII | [U-98% 15N] | 2 mM |
Bruker ARX - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
9 | sodium phosphate | natural abundance | 20 mM | |
10 | EDTA | natural abundance | 0.5 mM | |
11 | sodium azide | natural abundance | 0.05 mM | |
12 | Pab PolII | [U-98% 15N] | 2 mM |
Bruker ARX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 20 mM | |
14 | EDTA | natural abundance | 0.5 mM | |
15 | sodium azide | natural abundance | 0.05 mM | |
16 | Pab PolII | [U-98% 13C; U-98% 15N] | 2 mM |
Bruker ARX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 320 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | sodium phosphate | natural abundance | 20 mM | |
14 | EDTA | natural abundance | 0.5 mM | |
15 | sodium azide | natural abundance | 0.05 mM | |
16 | Pab PolII | [U-98% 13C; U-98% 15N] | 2 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_17418_2lcj.nef |
Input source #2: Coordindates | 2lcj.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 CFPGDTRILVQIDGVPQKITLRELYELFEDERYENMVYVRKKPKREIKVYSIDLETGKVVLTDIEDVIKAPATDHLIRFELEDGRSFETTVDHPVLVYEN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| CFPGDTRILVQIDGVPQKITLRELYELFEDERYENMVYVRKKPKREIKVYSIDLETGKVVLTDIEDVIKAPATDHLIRFELEDGRSFETTVDHPVLVYEN -------110-------120-------130-------140-------150-------160-------170-------180----- GRFIEKRAFEVKEGDKVLVSELELVEQSSSSQDNPKNENLGSPEHDQLLEIKNIKYVRANDDFVFSLNAKKYHNVIINENIVTHQ ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GRFIEKRAFEVKEGDKVLVSELELVEQSSSSQDNPKNENLGSPEHDQLLEIKNIKYVRANDDFVFSLNAKKYHNVIINENIVTHQ
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 185 | 0 | 0 | 100.0 |
Content subtype: combined_17418_2lcj.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 CFPGDTRILVQIDGVPQKITLRELYELFEDERYENMVYVRKKPKREIKVYSIDLETGKVVLTDIEDVIKAPATDHLIRFELEDGRSFETTVDHPVLVYEN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| CFPGDTRILVQIDGVPQKITLRELYELFEDERYENMVYVRKKPKREIKVYSIDLETGKVVLTDIEDVIKAPATDHLIRFELEDGRSFETTVDHPVLVYEN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180----- GRFIEKRAFEVKEGDKVLVSELELVEQSSSSQDNPKNENLGSPEHDQLLEIKNIKYVRANDDFVFSLNAKKYHNVIINENIVTHQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GRFIEKRAFEVKEGDKVLVSELELVEQSSSSQDNPKNENLGSPEHDQLLEIKNIKYVRANDDFVFSLNAKKYHNVIINENIVTH -------110-------120-------130-------140-------150-------160-------170-------180----
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1169 | 1074 | 91.9 |
13C chemical shifts | 871 | 585 | 67.2 |
15N chemical shifts | 205 | 183 | 89.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 370 | 360 | 97.3 |
13C chemical shifts | 370 | 182 | 49.2 |
15N chemical shifts | 178 | 173 | 97.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 799 | 714 | 89.4 |
13C chemical shifts | 501 | 403 | 80.4 |
15N chemical shifts | 27 | 10 | 37.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 112 | 111 | 99.1 |
13C chemical shifts | 112 | 102 | 91.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 44 | 56.4 |
13C chemical shifts | 78 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 CFPGDTRILVQIDGVPQKITLRELYELFEDERYENMVYVRKKPKREIKVYSIDLETGKVVLTDIEDVIKAPATDHLIRFELEDGRSFETTVDHPVLVYEN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| CFPGDTRILVQIDGVPQKITLRELYELFEDERYENMVYVRKKPKREIKVYSIDLETGKVVLTDIEDVIKAPATDHLIRFELEDGRSFETTVDHPVLVYEN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180----- GRFIEKRAFEVKEGDKVLVSELELVEQSSSSQDNPKNENLGSPEHDQLLEIKNIKYVRANDDFVFSLNAKKYHNVIINENIVTHQ |||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||| |||||||||| GRFIEKRAFEVKEGDKVLVSELELVEQS.SSQDNPKNENLGSPEHDQLLEIKNIKYVRANDDFVFSLNAKKYH.VIINENIVTH -------110-------120-------130-------140-------150-------160-------170-------180----
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 CFPGDTRILVQIDGVPQKITLRELYELFEDERYENMVYVRKKPKREIKVYSIDLETGKVVLTDIEDVIKAPATDHLIRFELEDGRSFETTVDHPVLVYEN ||| |||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||| |||||||| |||||||| ||||||||| CFP.DTRILVQIDGVPQKITLRELYELFEDERYENMVYVRKK.KREIKVYSIDLETGKVVLTDIEDVIKAPA.DHLIRFEL.DGRSFETT.DHPVLVYEN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160-------170-------180----- GRFIEKRAFEVKEGDKVLVSELELVEQSSSSQDNPKNENLGSPEHDQLLEIKNIKYVRANDDFVFSLNAKKYHNVIINENIVTHQ |||||||||||||||||||| ||| ||||||||||||| |||||||||||| |||||| ||||| GRFIEKRAFEVKEGDKVLVS....................GSP..DQLLEIKNIKYVR.NDDFVFSLNAKK.HNVIIN.NIVTH -------110-------120-------130-------140-------150-------160-------170-------180----
RDC restraints