H/ACA RNP protein Nhp2p
SKKLNKKVLK TVKKASKAKN VKRGVKEVVK ALRKGEKGLV VIAGDISPAD VISHIPVLCE DHSVPYIFIP SKQDLGAAGA TKRPTSVVFI VPGSNKKKDG KNKEEEYKES FNEVVKEVQA L
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.9 % (1137 of 1441) | 75.0 % (570 of 760) | 80.7 % (451 of 559) | 95.1 % (116 of 122) |
Backbone | 95.2 % (680 of 714) | 96.7 % (236 of 244) | 93.5 % (332 of 355) | 97.4 % (112 of 115) |
Sidechain | 67.5 % (567 of 840) | 64.7 % (334 of 516) | 72.2 % (229 of 317) | 57.1 % (4 of 7) |
Aromatic | 14.8 % (8 of 54) | 29.6 % (8 of 27) | 0.0 % (0 of 27) | |
Methyl | 85.1 % (126 of 148) | 93.2 % (69 of 74) | 77.0 % (57 of 74) |
1. Nhp2p
SKKLNKKVLK TVKKASKAKN VKRGVKEVVK ALRKGEKGLV VIAGDISPAD VISHIPVLCE DHSVPYIFIP SKQDLGAAGA TKRPTSVVFI VPGSNKKKDG KNKEEEYKES FNEVVKEVQA LSolvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | [U-13C; U-15N] | 20 mM | |
2 | potassium chloride | natural abundance | 200 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | D2O | natural abundance | 100 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | HEPES | [U-15N] | 20 mM | |
6 | potassium chloride | natural abundance | 200 mM | |
7 | DTT | natural abundance | 1 mM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | HEPES | [U-13C; U-15N] | 20 mM | |
11 | potassium chloride | natural abundance | 200 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | null | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | null | indirect | 0.1013291 |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | [U-13C; U-15N] | 20 mM | |
2 | potassium chloride | natural abundance | 200 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | [U-13C; U-15N] | 20 mM | |
2 | potassium chloride | natural abundance | 200 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | [U-13C; U-15N] | 20 mM | |
2 | potassium chloride | natural abundance | 200 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | HEPES | [U-15N] | 20 mM | |
6 | potassium chloride | natural abundance | 200 mM | |
7 | DTT | natural abundance | 1 mM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | [U-13C; U-15N] | 20 mM | |
2 | potassium chloride | natural abundance | 200 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | HEPES | [U-13C; U-15N] | 20 mM | |
11 | potassium chloride | natural abundance | 200 mM | |
12 | DTT | natural abundance | 1 mM | |
13 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | HEPES | [U-15N] | 20 mM | |
6 | potassium chloride | natural abundance | 200 mM | |
7 | DTT | natural abundance | 1 mM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
5 | HEPES | [U-15N] | 20 mM | |
6 | potassium chloride | natural abundance | 200 mM | |
7 | DTT | natural abundance | 1 mM | |
8 | D2O | natural abundance | 10 % | |
9 | H2O | natural abundance | 90 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | [U-13C; U-15N] | 20 mM | |
2 | potassium chloride | natural abundance | 200 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HEPES | [U-13C; U-15N] | 20 mM | |
2 | potassium chloride | natural abundance | 200 mM | |
3 | DTT | natural abundance | 1 mM | |
4 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17579_2lbx.nef |
Input source #2: Coordindates | 2lbx.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---40--------50--------60--------70--------80--------90-------100-------110-------120-------130----- SKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDG |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDG --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --140-------150------ KNKEEEYKESFNEVVKEVQAL ||||||||||||||||||||| KNKEEEYKESFNEVVKEVQAL -------110-------120-
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 121 | 0 | 0 | 100.0 |
Content subtype: combined_17579_2lbx.nef
Assigned chemical shifts
---40--------50--------60--------70--------80--------90-------100-------110-------120-------130----- SKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||| SKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGAT..PTSVVFIVPGSNKKKDG --140-------150------ KNKEEEYKESFNEVVKEVQAL |||| |||||||||||||||| KNKE.EYKESFNEVVKEVQAL
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
94 | CYS | HG | 2.239 |
142 | TYR | HH | 9.134 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 760 | 526 | 69.2 |
13C chemical shifts | 559 | 430 | 76.9 |
15N chemical shifts | 125 | 114 | 91.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 244 | 232 | 95.1 |
13C chemical shifts | 242 | 218 | 90.1 |
15N chemical shifts | 115 | 110 | 95.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 516 | 294 | 57.0 |
13C chemical shifts | 317 | 212 | 66.9 |
15N chemical shifts | 10 | 4 | 40.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 74 | 66 | 89.2 |
13C chemical shifts | 74 | 50 | 67.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 27 | 8 | 29.6 |
13C chemical shifts | 27 | 0 | 0.0 |
Distance restraints
---40--------50--------60--------70--------80--------90-------100-------110-------120-------130----- SKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDG |||||||||||||||||||||||||||||||||||||||||||||| ||||| |||||||||||||||| ||||||| |||||||||||| ||| .KKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDIS.ADVIS...VLCEDHSVPYIFIPSK..LGAAGAT...TSVVFIVPGSNK.KDG --140-------150------ KNKEEEYKESFNEVVKEVQAL ||| ||||||||||||||| KNK...YKESFNEVVKEVQAL
---40--------50--------60--------70--------80--------90-------100-------110-------120-------130----- SKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDG |||||||||||||| | | ||||||||||| ||||| || |||||||||| | | | |||||||||| | |||| ..KLNKKVLKTVKKAS...N.K.GVKEVVKALRK....LVVIA......DV..HIPVLCEDHS.P.I.I.SKQDLGAAGA.....S.VFIV......... --140-------150------ KNKEEEYKESFNEVVKEVQAL ||||||||||||||||||| ..KEEEYKESFNEVVKEVQAL
Dihedral angle restraints
---40--------50--------60--------70--------80--------90-------100-------110-------120-------130----- SKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDG ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| ||||||| ||||||| SKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFI.SKQDLGAAG......SVVFIVP.SNKKKDG --140-------150------ KNKEEEYKESFNEVVKEVQAL ||||||||||||||||| ....EEYKESFNEVVKEVQAL