Solution structure of the RMM-CTD domains of human LINE-1 ORF1p
MGNLRLIGVP ESDVENGTKL ENTLQDIIQE NFPNLARQAN VQIQEIQRTP QRYSSRRATP RHIIVRFTKV EMKEKMLRAA REKGRVTLKG KPIRLTVDLS AETLQARREW GPIFNILKEK NFQPRISYPA KLSFISEGEI KYFIDKQMLR DFVTTRPALK ELLKEALNME RNNRYQHHHH HH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 86.0 % (1944 of 2261) | 87.7 % (1054 of 1202) | 84.2 % (727 of 863) | 83.2 % (163 of 196) |
Backbone | 87.9 % (944 of 1074) | 89.5 % (324 of 362) | 87.0 % (469 of 539) | 87.3 % (151 of 173) |
Sidechain | 85.5 % (1165 of 1362) | 86.9 % (730 of 840) | 84.8 % (423 of 499) | 52.2 % (12 of 23) |
Aromatic | 51.4 % (73 of 142) | 81.7 % (58 of 71) | 20.0 % (14 of 70) | 100.0 % (1 of 1) |
Methyl | 96.9 % (190 of 196) | 95.9 % (94 of 98) | 98.0 % (96 of 98) |
1. L1ORF1p
MGNLRLIGVP ESDVENGTKL ENTLQDIIQE NFPNLARQAN VQIQEIQRTP QRYSSRRATP RHIIVRFTKV EMKEKMLRAA REKGRVTLKG KPIRLTVDLS AETLQARREW GPIFNILKEK NFQPRISYPA KLSFISEGEI KYFIDKQMLR DFVTTRPALK ELLKEALNME RNNRYQHHHH HHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L1ORF1p-RMM | [U-100% 15N] | 0.6 mM | |
2 | Tris | natural abundance | 5 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | L1ORF1p-RMM | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | Tris | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | L1ORF1p-CTD | [U-100% 15N] | 0.8 mM | |
12 | Tris | natural abundance | 5 mM | |
13 | sodium chloride | natural abundance | 300 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | L1ORF1p-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
17 | Tris | natural abundance | 5 mM | |
18 | sodium chloride | natural abundance | 300 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | L1ORF1p-RMM-CTD | [U-100% 15N] | 0.8 mM | |
22 | Tris | natural abundance | 5 mM | |
23 | sodium chloride | natural abundance | 300 mM | |
24 | H2O | natural abundance | 90 % | |
25 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | L1ORF1p-RMM-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
27 | Tris | natural abundance | 5 mM | |
28 | sodium chloride | natural abundance | 300 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 2.6 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L1ORF1p-RMM | [U-100% 15N] | 0.6 mM | |
2 | Tris | natural abundance | 5 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | L1ORF1p-RMM | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | Tris | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | L1ORF1p-RMM | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | Tris | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L1ORF1p-RMM | [U-100% 15N] | 0.6 mM | |
2 | Tris | natural abundance | 5 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | L1ORF1p-RMM | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | Tris | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | L1ORF1p-RMM | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | Tris | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | L1ORF1p-RMM | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | Tris | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | L1ORF1p-RMM | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | Tris | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | L1ORF1p-RMM | [U-100% 13C; U-100% 15N] | 0.8 mM | |
7 | Tris | natural abundance | 5 mM | |
8 | sodium chloride | natural abundance | 300 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | L1ORF1p-RMM | [U-100% 15N] | 0.6 mM | |
2 | Tris | natural abundance | 5 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | L1ORF1p-CTD | [U-100% 15N] | 0.8 mM | |
12 | Tris | natural abundance | 5 mM | |
13 | sodium chloride | natural abundance | 300 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | L1ORF1p-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
17 | Tris | natural abundance | 5 mM | |
18 | sodium chloride | natural abundance | 300 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | L1ORF1p-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
17 | Tris | natural abundance | 5 mM | |
18 | sodium chloride | natural abundance | 300 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | L1ORF1p-CTD | [U-100% 15N] | 0.8 mM | |
12 | Tris | natural abundance | 5 mM | |
13 | sodium chloride | natural abundance | 300 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | L1ORF1p-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
17 | Tris | natural abundance | 5 mM | |
18 | sodium chloride | natural abundance | 300 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | L1ORF1p-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
17 | Tris | natural abundance | 5 mM | |
18 | sodium chloride | natural abundance | 300 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | L1ORF1p-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
17 | Tris | natural abundance | 5 mM | |
18 | sodium chloride | natural abundance | 300 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | L1ORF1p-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
17 | Tris | natural abundance | 5 mM | |
18 | sodium chloride | natural abundance | 300 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | L1ORF1p-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
17 | Tris | natural abundance | 5 mM | |
18 | sodium chloride | natural abundance | 300 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | L1ORF1p-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
17 | Tris | natural abundance | 5 mM | |
18 | sodium chloride | natural abundance | 300 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | L1ORF1p-CTD | [U-100% 15N] | 0.8 mM | |
12 | Tris | natural abundance | 5 mM | |
13 | sodium chloride | natural abundance | 300 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | L1ORF1p-RMM-CTD | [U-100% 15N] | 0.8 mM | |
22 | Tris | natural abundance | 5 mM | |
23 | sodium chloride | natural abundance | 300 mM | |
24 | H2O | natural abundance | 90 % | |
25 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | L1ORF1p-RMM-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
27 | Tris | natural abundance | 5 mM | |
28 | sodium chloride | natural abundance | 300 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | L1ORF1p-RMM-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
27 | Tris | natural abundance | 5 mM | |
28 | sodium chloride | natural abundance | 300 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | L1ORF1p-RMM-CTD | [U-100% 15N] | 0.8 mM | |
22 | Tris | natural abundance | 5 mM | |
23 | sodium chloride | natural abundance | 300 mM | |
24 | H2O | natural abundance | 90 % | |
25 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | L1ORF1p-RMM-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
27 | Tris | natural abundance | 5 mM | |
28 | sodium chloride | natural abundance | 300 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | L1ORF1p-RMM-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
27 | Tris | natural abundance | 5 mM | |
28 | sodium chloride | natural abundance | 300 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | L1ORF1p-RMM-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
27 | Tris | natural abundance | 5 mM | |
28 | sodium chloride | natural abundance | 300 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | L1ORF1p-RMM-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
27 | Tris | natural abundance | 5 mM | |
28 | sodium chloride | natural abundance | 300 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | L1ORF1p-RMM-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
27 | Tris | natural abundance | 5 mM | |
28 | sodium chloride | natural abundance | 300 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | L1ORF1p-RMM-CTD | [U-100% 13C; U-100% 15N] | 0.8 mM | |
27 | Tris | natural abundance | 5 mM | |
28 | sodium chloride | natural abundance | 300 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 291 K, pH 8.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | L1ORF1p-RMM-CTD | [U-100% 15N] | 0.8 mM | |
22 | Tris | natural abundance | 5 mM | |
23 | sodium chloride | natural abundance | 300 mM | |
24 | H2O | natural abundance | 90 % | |
25 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17686_2ldy.nef |
Input source #2: Coordindates | 2ldy.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- MGNLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQANVQIQEIQRTPQRYSSRRATPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVDLS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGNLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQANVQIQEIQRTPQRYSSRRATPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVDLS --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 ---260-------270-------280-------290-------300-------310-------320-------330------ AETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNMERNNRYQHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNMERNNRYQHHHHHH -------110-------120-------130-------140-------150-------160-------170-------180--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 182 | 0 | 0 | 100.0 |
Content subtype: combined_17686_2ldy.nef
Assigned chemical shifts
---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- MGNLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQANVQIQEIQRTPQRYSSRRATPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVDLS |||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| | .GNLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQANVQIQEIQRTPQRY..RRATPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVD.S ---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- ---260-------270-------280-------290-------300-------310-------320-------330------ AETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNMERNNRYQHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNMERNNR ---260-------270-------280-------290-------300-------310-------320--------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1202 | 1038 | 86.4 |
13C chemical shifts | 863 | 697 | 80.8 |
15N chemical shifts | 215 | 153 | 71.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 362 | 313 | 86.5 |
13C chemical shifts | 364 | 287 | 78.8 |
15N chemical shifts | 173 | 140 | 80.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 840 | 725 | 86.3 |
13C chemical shifts | 499 | 410 | 82.2 |
15N chemical shifts | 42 | 13 | 31.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 103 | 99 | 96.1 |
13C chemical shifts | 103 | 99 | 96.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 71 | 54 | 76.1 |
13C chemical shifts | 70 | 4 | 5.7 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- MGNLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQANVQIQEIQRTPQRYSSRRATPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVDLS |||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||| ..NLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQANVQIQEIQRTPQR....RATPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTV... ---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- ---260-------270-------280-------290-------300-------310-------320-------330------ AETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNMERNNRYQHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .ETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALN ---260-------270-------280-------290-------300-------310-------320--
---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- MGNLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQANVQIQEIQRTPQRYSSRRATPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVDLS | |||| | | ||||||||||||||||||||||||| | || ||||| |||||||||||||||||||||||| | | | || | .G.LRLI.V..S..ENGTKLENTLQDIIQENFPNLARQA..Q.QE.QRTPQ.........RHIIVRFTKVEMKEKMLRAAREKG.V.L..K.IR.T.... ---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- ---260-------270-------280-------290-------300-------310-------320-------330------ AETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNMERNNRYQHHHHHH |||||||||||||||||||||| | | |||||| | | | ||||||||||||||||||| | AETLQARREWGPIFNILKEKNF..R.S...KLSFIS..E.K.F..KQMLRDFVTTRPALKELLK..L ---260-------270-------280-------290-------300-------310-------320-
Dihedral angle restraints
---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- MGNLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQANVQIQEIQRTPQRYSSRRATPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVDLS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGNLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQANVQIQEIQRTPQRYSSRRATPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVDLS ---160-------170-------180-------190-------200-------210-------220-------230-------240-------250---- ---260-------270-------280-------290-------300-------310-------320-------330------ AETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNMERNNRYQHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNMERNNRYQ ---260-------270-------280-------290-------300-------310-------320-------330