Solution NMR structure of Diiron protein in presence of 2 eq Zn2+, Northeast Structural Genomics Consortium Target OR21
MDELRELLKA EQQGIKILKE VLKKAKEGDE QELARLNQEI VKAEKQGVKV YKEAAEKARN PEKRQVIDKI LEDEEKHIEW HKAASKQGNA EQFASLVQQH LQDEQRHVEE IEKKN
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.6 % (1289 of 1423) | 98.2 % (749 of 763) | 78.3 % (414 of 529) | 96.2 % (126 of 131) |
Backbone | 82.4 % (567 of 688) | 97.4 % (227 of 233) | 67.7 % (231 of 341) | 95.6 % (109 of 114) |
Sidechain | 98.3 % (832 of 846) | 98.5 % (522 of 530) | 98.0 % (293 of 299) | 100.0 % (17 of 17) |
Aromatic | 91.3 % (42 of 46) | 100.0 % (23 of 23) | 81.8 % (18 of 22) | 100.0 % (1 of 1) |
Methyl | 100.0 % (118 of 118) | 100.0 % (59 of 59) | 100.0 % (59 of 59) |
1. entity 1
MDELRELLKA EQQGIKILKE VLKKAKEGDE QELARLNQEI VKAEKQGVKV YKEAAEKARN PEKRQVIDKI LEDEEKHIEW HKAASKQGNA EQFASLVQQH LQDEQRHVEE IEKKNSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 95.0 % | |
3 | D2O | natural abundance | 5.0 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity_1 | [U-10% 13C; U-100% 15N] | 0.3 mM | |
5 | H2O | natural abundance | 95.0 % | |
6 | D2O | natural abundance | 5.0 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 95.0 % | |
3 | D2O | natural abundance | 5.0 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 95.0 % | |
3 | D2O | natural abundance | 5.0 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 95.0 % | |
3 | D2O | natural abundance | 5.0 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 95.0 % | |
3 | D2O | natural abundance | 5.0 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 95.0 % | |
3 | D2O | natural abundance | 5.0 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 95.0 % | |
3 | D2O | natural abundance | 5.0 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 95.0 % | |
3 | D2O | natural abundance | 5.0 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 95.0 % | |
3 | D2O | natural abundance | 5.0 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 95.0 % | |
3 | D2O | natural abundance | 5.0 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.8 mM | |
2 | H2O | natural abundance | 95.0 % | |
3 | D2O | natural abundance | 5.0 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | entity_1 | [U-10% 13C; U-100% 15N] | 0.3 mM | |
5 | H2O | natural abundance | 95.0 % | |
6 | D2O | natural abundance | 5.0 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_17749_2lfd.nef |
Input source #2: Coordindates | 2lfd.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
1:74:GLU:OE1 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:107:HIS:ND1 | 2:2:ZN:ZN | unknown | unknown | n/a |
1:44:GLU:OE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:77:HIS:ND1 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:100:HIS:NE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:11:GLU:OE1 | 2:2:ZN:ZN | unknown | unknown | n/a |
1:74:GLU:OE2 | 2:2:ZN:ZN | unknown | unknown | n/a |
1:44:GLU:OE1 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:104:GLU:OE1 | 2:2:ZN:ZN | unknown | unknown | n/a |
1:104:GLU:OE1 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:104:GLU:OE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:11:GLU:OE2 | 2:2:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
B | 2 | ZN | ZINC ION | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDELRELLKAEQQGIKILKEVLKKAKEGDEQELARLNQEIVKAEKQGVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWHKAASKQGNAEQFASLVQQH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDELRELLKAEQQGIKILKEVLKKAKEGDEQELARLNQEIVKAEKQGVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWHKAASKQGNAEQFASLVQQH -------110----- LQDEQRHVEEIEKKN ||||||||||||||| LQDEQRHVEEIEKKN
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 115 | 0 | 0 | 100.0 |
Content subtype: combined_17749_2lfd.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDELRELLKAEQQGIKILKEVLKKAKEGDEQELARLNQEIVKAEKQGVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWHKAASKQGNAEQFASLVQQH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MDELRELLKAEQQGIKILKEVLKKAKEGDEQELARLNQEIVKAEKQGVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWHKAASKQGNAEQFASLVQQH -------110----- LQDEQRHVEEIEKKN ||||||||||||||| LQDEQRHVEEIEKKN
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
100 | HIS | HD1 | 11.66 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 763 | 748 | 98.0 |
13C chemical shifts | 529 | 407 | 76.9 |
15N chemical shifts | 136 | 126 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 233 | 227 | 97.4 |
13C chemical shifts | 230 | 114 | 49.6 |
15N chemical shifts | 114 | 109 | 95.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 530 | 521 | 98.3 |
13C chemical shifts | 299 | 293 | 98.0 |
15N chemical shifts | 22 | 17 | 77.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 60 | 100.0 |
13C chemical shifts | 60 | 60 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 23 | 23 | 100.0 |
13C chemical shifts | 22 | 18 | 81.8 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDELRELLKAEQQGIKILKEVLKKAKEGDEQELARLNQEIVKAEKQGVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWHKAASKQGNAEQFASLVQQH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...LRELLKAEQQGIKILKEVLKKAKEGDEQELARLNQEIVKAEKQGVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWHKAASKQGNAEQFASLVQQH -------110----- LQDEQRHVEEIEKKN ||||||||||||||| LQDEQRHVEEIEKKN
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MDELRELLKAEQQGIKILKEVLKKAKEGDEQELARLNQEIVKAEKQGVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWHKAASKQGNAEQFASLVQQH |||||||||||||||||||||||| ||||||||||||||||||||||||||| ||||||||||||||||||||||||| ||||||||||| ...LRELLKAEQQGIKILKEVLKKAKE..EQELARLNQEIVKAEKQGVKVYKEAAE....PEKRQVIDKILEDEEKHIEWHKAAS....AEQFASLVQQH --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110----- LQDEQRHVEEIEKKN ||||||||||||| LQDEQRHVEEIEK -------110---